KEGG   Cryptococcus neoformans B-3501A: CNBL0530Help
Entry
CNBL0530          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CNBL0530
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CNBL0530
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CNBL0530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 475 aa AA seqDB search
MPELPEVERARKLIEDSCKGYKIASVDAQEDSIIFTGGTDHNEFAKEIAGRSITGCERKG
KTFWMTLSGEGRYPVMHFGMTGMIQLKGQEPTWYRRRPKESADVWPPRFYKFVLKLEPQE
GSIADEPRELAFIDGRRLGRLRLVSDPVSSHPPVSELGFDPILNHPTLEEFTKLLVNKKG
TVKGVIMDQAFSAGVGNWVADEVLYQARIHPSCPIPALSEQNIRDLHHQLRAVPLTAISV
NADSKLFPSDWLFRWRWSKGTTQKKQMEKDKKSKGKKVVDGEGGEDVEPEDKEFLELPDG
SPATIKFIEVGGRTTALVEELQKMPEGVEIKPKISKGGKRAGAKRKKVAKEEESDEESEL
SDQSDLEEQKPKRPLTARQKAAAEKKGINSNLASQTKTEDNKPSAAKRRAIGARTGGSKN
HPDSEVKKEKGSTECRKSKKQVEAVGEKLAKIKPQKGRKKAASTPESSELSDLVE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccagagctccctgaggttgaacgagctcggaaacttattgaagactcctgcaagggg
tacaagatcgcttcagtcgatgctcaagaagacagtatcatctttaccggtggaacagac
cataacgagtttgccaaagagatcgcaggaaggtctataacaggatgtgagcggaaagga
aaaacgttctggatgaccttgtcgggtgaaggacgatacccggtgatgcatttcggcatg
acaggtatgatacagctcaaaggtcaagaaccaacttggtatcggagaagacccaaagaa
agtgcggatgtctggcctcccagattctataagttcgtattaaagcttgaacctcaagaa
ggctccatcgccgacgaacctcgagaacttgctttcatagatgggcgtcggcttggtcgt
cttcgtttggtatctgatcctgtatcttctcatcctcccgtctcggagttaggtttcgac
cctatactcaatcatccaactttggaagagtttacaaagctgctggtgaacaagaaaggt
actgtgaaaggcgtcatcatggaccaagcattcagtgcgggtgttggcaattgggttgca
gacgaggtactttaccaggcccgtatccacccttcttgccccattcccgcattatccgaa
caaaacattagagatctccaccaccaactccgtgctgtgcctctcaccgcaatatctgtc
aatgctgattcgaaactttttccttccgactggctcttccgctggaggtggagtaaaggt
acaactcagaaaaagcagatggagaaggacaaaaagagtaaagggaagaaggtcgtggac
ggtgaggggggtgaggacgtggagccggaggataaagagtttttggagcttcccgatgga
tcaccagccacgatcaaatttattgaagtcggtggacgaacgactgcactagtcgaagaa
ctgcaaaagatgccggaaggagtcgagatcaagccgaaaatcagtaaaggcggcaaaagg
gccggagcgaagaggaagaaggtcgctaaggaggaagaatcggatgaagagagtgaacta
tccgaccagagtgatttagaagagcagaaacccaaaagacctctgacggcaagacaaaaa
gcagccgcagagaaaaaggggatcaacagtaatttagcctcgcagacgaaaactgaagat
aataaaccttctgctgcaaaacgacgagccattggagcaaggactggggggtccaaaaat
catccggattcggaggtgaagaaggaaaaagggagtacagaatgtcgtaaatccaagaag
caagtggaggcagttggcgaaaaacttgcaaagatcaagcctcaaaagggtagaaagaag
gcagcttcaactccagagtcttcagaactgtccgatcttgtcgaatag

DBGET integrated database retrieval system