KEGG   Cryptococcus neoformans B-3501A: CNBL0680Help
Entry
CNBL0680          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CNBL0680
Enzymes [BR:cnb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CNBL0680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 1697 aa AA seqDB search
MSIANSSSSPEDQNITSLLENHSRETGELPSPPLVEDRAAPNGMKLDGENIVGQSNGISA
AQAAVTTSRTSSLTSNLNRPQSVSGAQPAVASSSRSTINSPPRRYLLISQQSPSSRTTPC
RSAGTASPTSRPPTPPLPPTQSTPVTVSGLSAPSILSPVPAASSAISPTIPSIPLHAPLP
YPTLSLPPSATPALPNSFTLSASTILPADSSTSALPSTSAAGLPVMPVFISPATSSPAGP
EPSTLQSASEVTKSSNQKESPRKTDSKQAPSPSSTHGLWTNTRPFHASSNLSATSGKSSA
ASSRSTSRTLLPGRAATSDNVAGPSKTTSVSSTHPPARAPSLSLPSEPEKQVHPRSPSHE
GVGKREKKSKALSSGTGQSTPSRSSLSTYDVASNRKTKSTGLNALPQKPSSAGKTSSIPQ
RTSTLATAMAIRPFIRSPTSPCRPSSFEASGPIQSSGGAVKAAQTQDKIHPLSTTSSISS
HSRETTTKAATPSHVTISSPSPSQSTSALTTVHVTQDAQKSATTSPTREKIHPSRRKSQT
SDCVVAPTTSQTAASLSYPAGTSDGTGEAGKKAAETSVHAGPSSADFGAFVVPPTTAIAS
TTVSPSVTPPEDAPFLKSGPSVHPLFHAASAIGGQDTLTETGAVGDVLSQGSKGRASSPR
ITTTGAVSHLVLPIDVGSEIKPTAAPSLFASGVTIENVDDQAAAQPQNQAPLPSALSVLS
KKNLGSSSKESSVKSAASSVSSSSTLGDSVSGLGRKSHHKSTQSIPQSPLPTTNTSNSSG
IEVNSWLNPQPFGPSFAASHLNTHAKKKWKGKEREKEREKEKAREKEKAKEENEQLRRRR
MADLEKISATLEKYKGRMGVESRTRSIPRADGENRKRPPSPGISASTDGEVRVVKRSKPA
WAIGPENGHVAAAMEKETNDNKKTTDAIKINHQPAAFYTPQFATPTSAAKTTTTPLSVTA
GLGPPVNSSSSSSTPSLLSRSINLDIPRETPEERMDDDDGNDSTGGLLVRKTGKNDAVEE
QVEQVRLDLDDVSIHGSSPVGPISTFTSRFRNVSITPSQTQKILEQPGEDVPIRRSAIKI
NGKQKAQRSKDKSDGSESEDDVPLNWPSRKGKGKAAPEPQDNSETQRDDDGVNLGSSNGE
EGSSDDHSNPVLPPFLFKDRPAHVRQPLQTLFKGGFVAKHSYQRPLVKSSAVSPVPNANR
TSSEPSAKADLLPQKRKRRPKKLTREQWHHIAQNHLSDVDDLLDESSKKRLSPKSAEKLG
ADLSKLTSPRVFSIVSRSEPRSKGAPIEENDNEYFTDSDSHTSDIALFLQHPDPPPPPER
IREAKRNFGTRTIDPWNRQKHTFRSNPALHRAIFEAYIMQSTSMEESGGDDIKVTNEVDA
DGGPPDFEFVYSDTMLYPDGIPPPELGLGCDCDGPCDPDSETCTCVKRQELYFYDLGLKG
FAYDENGKIRENSASIWECNELCGCPPECMNRVIQRGRAKDTGIEIFKTKEKGWGIRARS
FIPSGTYIGSYTGELIREAESERRGVTYTAIGRTYVFDLDGWQIRHPPKGLEKIDKRAAE
LAEAVKMRAKAAMRESQEDAYNAYSVDAFHYGNFTRYFNHSCDPNLAITQAYVKDFHPER
PLLVIFTRRDIKKHEELCISYKGIPDDDVPSPEPVKKKKGNKGKKQMSKTSASAHPPEMI
ALNSDKGPVEVKDICRW
NT seq 5094 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagcaaattcgtcttcttcaccagaagatcagaatatcaccagtcttttggaa
aatcattctcgagagacaggagagctgcctagtccgcctttagttgaggatcgtgcggca
ccgaatggaatgaaactcgatggggagaacattgttggtcagagtaatgggattagtgct
gctcaagcggcggtaaccacatctagaacgtcttcattgacatcaaatttaaacagaccc
caatcggtctctggggctcaacctgctgtcgcttcctctagcagatctaccatcaattct
cctcccagacgataccttttgatatcccaacagtcaccttcgtctcgtacgacaccttgc
agatctgccggtactgcgtctcccacttcaagacccccaactcctccattaccgccaaca
cagtcaacacctgtaactgtatcagggctttcagcgccctcgatactctcccctgtaccg
gctgcttcatcagccatctcgcccaccataccttcaatacctttacacgctccacttccc
tatcctacactatctttaccgccttcagctacaccagcacttccaaattcctttacactt
tctgcatccactatccttcctgcagattcttcaacttctgcacttccatcaacttctgca
gcaggtttacctgtgatgcctgtattcatttcacccgctacatcttctccagctggtcct
gaaccatcaactcttcaatccgcttcagaagtcacaaaatcatctaaccaaaaagaatcg
ccaaggaaaacggactccaaacaagcgccttccccttcaagtacccatggtttgtggacg
aatacaaggccatttcacgcttcttctaatttatcagctacgtctgggaaatcttcagca
gcttcgtcgagatcgacatctcggacactgttacctggtcgtgcggctacgagtgacaat
gttgccggtccctcaaaaacgacttctgtttcatcaactcacccaccagctagagcccca
tcgttatctctaccctcagagccagaaaagcaagttcacccaaggtcgccatctcatgaa
ggcgtaggaaagagggagaagaaatccaaggcgctttcttctggtactggccaaagtaca
ccctcaagatcttcattatcaacctacgatgtggcctcaaatcggaaaactaaatcgact
ggccttaatgcgttaccacaaaagccctccagtgcaggtaagacctcaagtatcccgcaa
agaaccagtacattggccacggccatggccatacgtccgtttattcgatcgccaacttct
ccttgtcgaccatcgtcgtttgaagcttccggacctatccagtcttccggaggagcagta
aaagccgctcaaactcaagataaaatacatccattgtcgacaacatcgtccatatcttcc
cattctagggaaacaacgacaaaggccgccacaccctcccacgtcacaatttcatcacca
tcgccttcccaatccacttcagcattgacaacagtgcacgtgacacaagatgctcaaaag
tcagcaacaacctcacctaccagagaaaagatacatccttctagaaggaagagccagaca
agcgattgtgtggttgctccgacaacttcccagactgcggcctccttgtcatatccggca
gggacatcagatgggactggagaagctggtaagaaggccgcggaaacctctgttcacgca
ggaccatcttccgctgattttggagcatttgtagtgcctcctacaaccgctattgcatcc
acgactgtgtctccctcggtgactccacctgaagatgctccttttttaaagtcgggtcca
tcagttcatccactctttcacgctgcgtctgcaattgggggtcaggatactttaaccgag
acgggagcagttggtgacgtgttgtcgcaaggatcaaaaggccgggcatcatcaccccgg
ataacaactactggagcagtttcgcatcttgtgctacctattgatgtaggctcagaaatc
aagccaacagcagcgccttcactctttgcatcaggtgtgactatcgaaaatgtcgatgat
caggctgctgcgcagccacaaaaccaggcacctcttccgtcagctttatctgttttgtcg
aagaagaacctagggtcatcgtccaaggagtcaagcgttaaatctgctgcatcgtctgtc
tccagctcaagcaccctgggcgattcggtttccggactcggtagaaaatcgcatcacaag
tcgacgcagtcgataccccaaagtccgctcccgacgactaataccagcaatagcagcggc
atagaagtcaattcttggcttaatccgcaacctttcggtccttctttcgccgcttcgcat
ttgaatacacatgccaagaagaagtggaaaggaaaggaaagagagaaggagagggaaaag
gaaaaggctcgagagaaggaaaaggcgaaagaagagaacgagcaattgaggcgaagacga
atggcagatttggagaagatttcggcaaccctggaaaagtataaaggacgtatgggcgtt
gaatctcgaactcgctcgatccctcgtgcggatggcgaaaacagaaagcggccgccaagt
ccaggaatcagtgcaagtactgatggggaggtgagagttgtgaagaggagcaaaccagcg
tgggctatcgggcctgaaaatggacacgtcgctgccgcaatggagaaagaaacaaatgac
aacaagaagacgacggatgccatcaaaatcaatcatcaaccagcagcgttttatactccc
cagtttgctactcccacctcagctgctaagacaactacaactcctctatctgttactgcc
ggcttgggaccaccagtcaattcttccagctcatccagtacgccttcattgcttagtcgt
tcgattaatttagatataccgagggagacgccggaagagcgtatggatgatgacgacgga
aatgattcgacaggtgggttgctagtcagaaaaaccgggaaaaatgatgctgtcgaagag
caagtggagcaagtccgtctggatttggatgatgtctctatacacggtagctcccccgtt
gggccaatttctactttcacctcacggtttaggaatgtgtctatcacgccctctcagact
caaaagatattagagcagccaggtgaagatgtacctatccgacggtctgccataaagata
aatgggaagcaaaaggcgcaacgcagcaaggataagagtgatggaagcgagagtgaggat
gatgttcctctcaactggccttcaaggaaaggaaaggggaaagccgctcccgaaccccaa
gataattcagaaacacaaagggatgatgatggtgtgaatttgggatcaagcaatggagag
gaggggtccagcgacgaccactctaatcctgttctaccgcctttcttattcaaagatcgg
cctgcgcatgtgcgacagccgttgcagacacttttcaaaggcggatttgttgcaaaacat
agctaccagcgccctcttgtcaagtcttctgctgtttctcccgttccgaatgccaatcgc
acctcctctgagccatctgccaaagctgacctgctgccccaaaagcgcaaacgtaggccc
aagaaacttaccagagagcaatggcaccacatcgcacagaaccatttgtcagatgttgat
gacctgcttgacgaatcttcaaagaagaggttgagtccgaagagtgcggagaagctcggt
gccgatctttccaagctcacaagtcctcgcgttttctctatcgtttctcgttcagagccc
cggtcaaagggagcgcccattgaagaaaatgataacgagtactttacggactctgactca
catacatctgacattgccctgttcctccaacatcctgatcctcctcctcctcccgagcgc
attcgagaagccaagcgcaatttcggtacgcgtaccatcgatccatggaacaggcagaag
catacttttcgatccaacccggctctgcatcgtgccatctttgaggcatatattatgcag
tctacgtcaatggaagagtcgggtggggatgatatcaaggtgacgaatgaggtcgacgca
gatggtggtccgccggactttgagtttgtgtattcagatactatgttatatccggacggt
ataccgccaccagagctaggtttggggtgcgattgtgatggaccttgcgatccggattct
gagacttgtacttgtgtaaagaggcaagagctttacttttatgatctgggcttgaaaggt
ttcgcatatgatgaaaatggcaaaatcagagaaaactctgcttccatttgggagtgtaac
gagctatgtggatgtcctcctgagtgtatgaatcgcgttatccaacgaggccgtgccaag
gataccggaatagagattttcaagaccaaagaaaaaggttggggtatccgcgctcggtca
ttcataccaagtggaacatacattggcagttacacaggagaactgattagggaggcggaa
agtgaacgacgaggagttacctacaccgccattggtcgaacatacgttttcgacctcgac
ggatggcaaattcggcacccacccaaggggttggagaagattgataaacgcgccgcagag
ctagctgaagcggtgaaaatgagagccaaggctgcaatgcgagagagccaagaagatgct
tacaatgcatatagtgtggatgctttccattatgggaacttcactcgctattttaatcac
tcatgtgatcccaatttggcgattacccaagcatatgtcaaggacttccatccagaacga
ccattgcttgtgatctttactcgtcgagacatcaaaaagcacgaagaactttgtatcagt
tacaagggtatacccgatgacgacgttccatccccagagcctgtcaaaaagaagaaggga
aataagggcaagaaacagatgtctaaaacatctgcttcggcacatccgccagagatgata
gctttgaattcagacaaaggcccggtggaagtgaaggatatctgtcgatggtaa

DBGET integrated database retrieval system