KEGG   Cryptococcus neoformans B-3501A: CNBL0870Help
Entry
CNBL0870          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cnb00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 592 aa AA seqDB search
MCGIFCCFNRAGDISQYRARAIACSKRQRHRGPDWSGCYMTNNTVLVHERLAIVGVDTGA
QPLTNEDESLVLAVNGEIYNHVALRKSLKNKDAVFKTHSDCEVIMHLYKEHDTGLCNMLD
GMFSFVLVDKSVSPPRLIAARDPIGITTLYMGWNSQSPDTLYFASELKCIHEECDNLQAF
PPGHFYDSKEKKLTRYFNPSWWDSDKGVVPHNDIDYKLLRETLEAAVKKRLMSEVPYGVL
LSGGLDSSLIASIAARETDKLAEEQEKLRQERKQAIASGKWVGDEQPLASWPQLHSFAIG
LPGAPDLIAARKAADFLGTIHHEYNFTVQEGLDAIPEVIHHLETYDVTTVRASTPMYLLS
RKIKAMGVKMVLSGEGSDEIFGGYLYFHAAPTAKDFHEECVKRVKNLHTADCLRANKSTM
AWGLEARVPFLDKTFLEVSMNVDAKYKMFSKGTHQEVDEDGRPKMEKYILRKAFDCSPEG
KAYLPDSILWRQKEQFSDGVGYSWIDGMKDHAAAIVSDEKFANRATRWPLDTPDTKEAYW
IREIFEHHFPTEAAAKTAVRWVPKQEWGVSSDPSGRAVSIHTAAYADGEAKA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatcttctgctgcttcaaccgtgccggagacatctctcaataccgagcccga
gccatcgcctgctccaagaggcagcgacaccgtggccccgattggtcaggctgttacatg
accaacaataccgtcctcgtccacgagcgattagccattgttggtgtcgacaccggtgct
caaccccttaccaacgaagacgaaagccttgtcctcgccgttaacggtgaaatttacaac
cacgtcgctctcagaaaaagtctcaagaacaaagatgccgtgttcaagacccactcggac
tgtgaagtcatcatgcacctctacaaggagcacgacaccggtctctgcaacatgcttgac
gggatgttctcctttgtcctcgttgacaagtccgtctctcctcctcgattgatcgctgcc
cgtgatcctatcggtatcaccactctctatatgggctggaactctcagtctcccgacact
ctttactttgcttctgagctcaagtgtatccacgaggagtgcgacaacctccaggctttc
cctcccggacatttctacgattccaaggagaagaagctcactcgatacttcaacccttca
tggtgggactctgacaagggtgttgtccctcacaacgacattgactacaagcttttgaga
gaaactcttgaagctgccgtcaagaagaggttgatgtccgaagttccctatggtgtcctc
ctctcaggtggccttgactccagtttgatcgcttccatcgccgctagagaaacagacaaa
ctcgctgaggagcaagaaaaattgagacaagaacgaaaacaggctattgcgtctggcaag
tgggttggtgacgagcagccccttgcttcttggcctcaactccactcttttgccatcggt
ctccctggcgccccagatcttatcgctgcccgaaaggctgccgacttccttggtactatc
caccacgaatacaactttaccgttcaggagggtcttgatgccatccctgaagtcatccac
caccttgagacttatgatgttaccactgtccgagctagtacccctatgtaccttctcagt
aggaagatcaaagctatgggtgtgaagatggtcttgtctggtgagggtagtgacgaaatc
tttggtggttacctctacttccacgccgctcccaccgccaaagacttccacgaggaatgc
gttaagcgtgtgaagaacctccacaccgctgactgtctccgtgccaacaagtctaccatg
gcttggggtcttgaagcccgtgttcccttccttgacaagactttcctagaggtctccatg
aacgtcgatgccaagtacaagatgttctccaagggcactcaccaagaggttgacgaggat
ggtcgacccaagatggagaagtacatcttgagaaaggcgtttgactgctctcctgagggg
aaggcgtacttgcctgactctatcctctggaggcaaaaagaacaattctctgatggtgtc
ggttactcttggattgacggcatgaaggaccacgccgccgcgatcgtctccgacgaaaag
ttcgccaaccgagccacccgatggcccctcgatactcctgataccaaggaggcttattgg
atccgtgagatctttgaacaccacttccctactgaagcggctgccaagactgctgtccga
tgggtccccaagcaggaatggggtgtgtcttccgacccttccggtagggctgtgtctatc
cacactgcggcgtatgcggacggcgaggccaaggcttaa

DBGET integrated database retrieval system