KEGG   Cryptococcus neoformans B-3501A: CNBL1180Help
Entry
CNBL1180          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CNBL1180
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CNBL1180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 352 aa AA seqDB search
MAAARFLSSARIARPSVISRTAAQYRGYSSAAPSGGANWPLLLSVAGATGVGAYAYLQYN
PSVKKEVEAKIKGAEAEKAAAERTAAGISAFVKDTWIPFTLEKVEKYNHNTNIYHFSFGE
EGKDKISGGEVASVVLLRSPEGPEQIKDEKDKPIIRPYTPISPPDQKGSIEFMIKSYSGG
KFTPFLSNLSPGQQVLFKGPLQKFKYQPNSFEKGLCIAGGSGITPMWQLINHSLSIPEDK
TKWTLIYSNVSEADILLRKEFDALAQKYPGRLDIKYVLDKGPWGWKGETGYVTADLIKKT
FPKNEGENIRAFVCGPPGQMKAVSGEKDGMKQGELAGALKELGYTSDEVFKY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctaggttcctctcttctgctaggattgcccgtccttccgtcatttccagg
actgccgctcagtaccgaggctactcttctgctgctccttccggcggcgccaactggccc
ttactcttgtctgttgccggtgctaccggtgtcggtgcatacgcgtacctccagtacaac
ccttctgtcaagaaggaggtcgaggccaagatcaagggcgctgaggctgaaaaggctgct
gctgagcgtaccgctgccggtatcagcgctttcgtcaaggacacttggatcccctttacc
ctcgagaaggttgaaaagtacaaccacaacactaacatctaccacttcagctttggagag
gagggtaaagacaagatctctggcggtgaggtcgccagcgtcgtccttttgaggtctcct
gagggtcccgagcaaatcaaggacgaaaaagacaagcctatcatcaggccttacaccccc
atctcgcctcctgatcagaaaggctccattgagtttatgatcaaatcgtactccggcggc
aagttcactccattccttagcaacctctcccctggtcagcaggtcctcttcaagggtccg
cttcagaagttcaagtaccagcccaacagcttcgagaagggtctctgtatcgctggtggt
tctggtattacccccatgtggcagctcattaatcactccttaagcattcccgaggacaag
accaagtggactcttatctactccaacgtctctgaggctgatatcttgttgagaaaggag
tttgacgctcttgcccaaaagtaccccggccgtcttgatatcaagtacgttctcgacaag
ggaccttggggctggaagggtgagactggttacgtcaccgccgatctcatcaagaagact
ttccccaagaacgagggcgagaatatccgtgcatttgtttgtggtcctcctggccagatg
aaggccgtgtccggtgagaaagacggtatgaagcagggtgagctcgctggcgccctcaag
gaattgggttacacttccgatgaggtcttcaagtactaa

DBGET integrated database retrieval system