KEGG   Cryptococcus neoformans B-3501A: CNBL2890Help
Entry
CNBL2890          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CNBL2890
   00240 Pyrimidine metabolism
    CNBL2890
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CNBL2890
   03410 Base excision repair
    CNBL2890
   03420 Nucleotide excision repair
    CNBL2890
   03430 Mismatch repair
    CNBL2890
   03440 Homologous recombination
    CNBL2890
DNA repair and recombination proteins [BR:cnb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CNBL2890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 205 aa AA seqDB search
MPPKKGSSTTTKSSGKTKKAAGLSQPTLGFQSQRKHSGTISKSKPSLQRQTSTISEINVE
PEGRSDSDIELLAGSDMKDKTTRMGGNKSTESSALPEQRTEDEEPKQLKVKSKEWAQVLK
AAKEAMGNLEPIHAHADTHNDIHHILRVFDMTAKYGPCVGISRLDRWKRAQKLGLEPPDE
IRTILTTQQGREDPSYRENVLNAWL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgccacctaaaaaaggatcatcaactactaccaagtcttctgggaagacaaagaaggct
gctggtctttcccaacctaccctcggctttcaatcccaacggaaacattccgggacaatc
agcaagtccaaaccctcattacagcgccagacatcgaccatctcggaaataaatgtggag
ccggagggacgaagtgatagcgacattgaactgctcgcgggttccgacatgaaggataaa
acaacacgcatgggggggaataaatctactgaaagtagtgcgctaccagaacaaaggacg
gaagatgaggaacccaagcaactaaaagtgaaaagtaaagaatgggcccaagttctgaag
gctgccaaagaagctatggggaaccttgagcccatccacgcacatgccgatacacacaat
gatatacaccatatccttcgggtctttgacatgaccgcgaaatatggcccttgcgtaggt
atcagtcggctggatagatggaaacgagcgcagaaactgggtcttgaacctcctgatgaa
ataaggacgatattaacaacccagcaagggcgagaggacccatcatatcgagagaatgtg
ttgaatgcgtggttgtag

DBGET integrated database retrieval system