KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBL2980Help
Entry
CNBL2980          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00620  Pyruvate metabolism
cnb00630  Glyoxylate and dicarboxylate metabolism
cnb01100  Metabolic pathways
cnb01110  Biosynthesis of secondary metabolites
cnb01200  Carbon metabolism
Module
cnb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNBL2980
   00630 Glyoxylate and dicarboxylate metabolism
    CNBL2980
Enzymes [BR:cnb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CNBL2980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 4939347
NCBI-ProteinID: XP_772432
UniProt: F5HDP7
Position
12
AA seq 538 aa AA seqDB search
MSLPQGIYLTAPIPKGGEHILSTEALEFLALLHRTFNKRRLELLKNREKVQAELDQGKPL
SFLPETREIRENLAWNCAPPGPGLEDRRVEITGPTDRKMVINALNSGAKTFMADFEDSNS
PTWSNMVLGQVNLYDAIRRQIDFEINGKAYKLSEKPAVLLVRPRGWHLPEPRLIIDGTPM
SGSLFDFGLYFFHNARELISRGSGPYFYLPKMEHHLEARLWNDAFCLATSHLGVQQGVIR
ATVLIETLPAAFQMEEILYELKEHSAGLNCGRWDYIFSFIKKQRAHKNCVFPDRSDVTMT
VPFMDAYVRLLIQTCHKRKVAAMGGMSAQIPIKNDPAANERAMSKVRADKLREVTAGHDG
TWVAHPALISIALEIFNQHMPGPNQYHIRREDVTVTDKQIADPSVPGKITEQGLRDNVSA
ALSYCAAWISGNGCVPINHLMEDAATAEIARVQLWQWCKYGSKTDSGKDINPSYVQTILS
EEASKVSKLPGIDPSHVKIASEYMAQQVKAQWPSDFLTSDLLGYLEGVGTKGGAKASL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccctcaaggcatctacctcactgctcccatccccaagggcggagagcacatc
ctctctaccgaagctctcgagtttctcgccttgctccacaggacattcaacaaacgaagg
ttggagttgttaaaaaaccgtgaaaaggtacaggccgagctggaccaaggcaagcccctc
tccttcctcccagagaccagggagattagggagaaccttgcttggaactgtgcccctccc
ggtccaggacttgaagaccgtcgagttgagatcactggcccaactgacaggaagatggtc
atcaacgctttgaactctggtgccaaaacttttatggccgactttgaggactccaattct
cctacctggtcaaacatggttctcggacaggtcaacctttacgatgctatccgacgacaa
attgactttgaaatcaatggcaaggcttacaagctctccgagaagccggctgtgcttttg
gtccgacctcgaggatggcacctccccgaaccccgtttgattatcgacggtactcccatg
tccggctccctcttcgactttggtctctactttttccacaacgcccgcgaactcatctct
cgaggttctggaccttatttctacctccccaagatggagcaccacctcgaagcgcgtctt
tggaacgatgccttctgccttgcaacaagtcatttaggtgtgcagcagggtgtaattagg
gcaactgttttaatcgagactttacctgcggcgttccaaatggaagagattttgtatgag
ttgaaggaacactctgcgggtttgaactgtgggcgatgggattatatcttcagtttcatc
aagaagcaacgtgcccacaagaactgtgtcttccctgaccgatctgacgttaccatgacc
gtccccttcatggacgcctacgtccgcctcctcatccaaacttgtcataagcgaaaggtc
gccgccatgggaggcatgtctgcccagattcctatcaagaacgatcccgctgccaatgag
cgtgccatgtccaaagttcgcgccgataagctccgtgaagtcactgcgggccatgatggc
acatgggtggctcaccccgcgctcatctccatcgcccttgagatctttaaccaacacatg
cccggtcctaaccagtaccacatccgccgcgaagacgttactgtcacagacaagcagatt
gccgacccctctgtccctgggaagattacagaacaagggttgagggataatgtgagcgcg
gctttgtcgtattgtgcggcgtggattagtgggaatggctgtgtgccgattaatcatttg
atggaggacgctgcgacggcggagattgcgagggtgcagctttggcagtggtgcaagtat
ggctccaagactgactccggcaaagacatcaatccttcttacgtccaaactattctctct
gaagaagcatccaaagtctcaaaactgcctggtattgatccatcacacgtcaagattgcg
tccgagtacatggcccagcaggtcaaggcccagtggccgagtgatttcttgacaagtgat
ttgttggggtaccttgaaggtgtcggtaccaaggggggcgccaaggctagcctttaa

DBGET integrated database retrieval system