KEGG   Cryptococcus neoformans B-3501A: CNBM0750Help
Entry
CNBM0750          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNBM0750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 366 aa AA seqDB search
MLSTFRTGVKDIELANPPTDSISRIEFSPTADILAVASWDNNVRLYDVNSQGQNQGKAMY
SHQAPVLDLTWSADGQYVFSSGCDNAAQMYNVQTQQAQQVAQHDAPIKCVEFAEVPGSGQ
VLITAGWDKKLKYWDLRSPNPIATIDLSDRAYSMSVAQQLLVCATGDRQLHVINLSSPTT
IFKSIESPLKWQTRVVSCFPTGDAFAVGSIEGRVAIQYPGEDDKRNFSFKCHRYDIPTGS
MPRTPAVSGSQNVFAINSLTFHKVQGTFCSGGSDGSLTFWDGISRTKLKTFSCKDLNNGD
TDVRPPRFGTPIVSTSFNRTQEIIAYAMSYDWSKGHSGVPPAGQNINKVMLHPVKPEEVN
KKPKRN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctctctaccttccgaaccggcgtcaaggatattgaactcgccaaccctcctacagac
tcaatctctagaatcgaattctctcccaccgccgacatacttgctgttgcgagttgggac
aacaatgtgcggttatacgacgtaaactcgcaagggcagaaccaagggaaggcgatgtac
tctcatcaggctcctgtgcttgatttaacttggtcggcagacggccaatatgtcttctcc
tccggatgcgacaacgctgctcaaatgtacaacgtccaaacacagcaagcacaacaagta
gctcaacatgatgcacccataaagtgtgttgaatttgccgaagtgccgggaagtggacag
gttttgattacagcgggttgggataagaaactcaagtactgggacttgagatcacccaac
cctattgcaactatcgacctctctgatagggcctattcgatgagcgttgctcaacaactg
ttggtctgtgctaccggtgaccgtcaactgcatgtcatcaatctttcaagccctaccacc
atcttcaagagtatcgagtcaccgttgaaatggcaaacacgagttgtcagctgttttcct
actggagacgcattcgctgttggaagtattgagggacgagtagctatccaataccctgga
gaggatgataagcgaaatttctctttcaaatgtcatcgatacgacatccctactggtagc
atgccgcgaactcccgccgtcagcggctcccagaatgttttcgctatcaactctctcact
ttccacaaggtgcagggaactttctgctctggtggcagcgacggtagtttgacattctgg
gacggtatctctcgaacaaagcttaagactttctcctgcaaggatttgaacaacggagac
acagatgtacgaccaccaagatttggtactcccatcgtgtctacttcctttaaccgaacc
caagaaatcatcgcgtatgccatgtcatatgattggtccaagggccacagcggtgtccca
cctgcgggacaaaacattaacaaagttatgttgcaccctgtcaagcctgaagaagtcaac
aagaagcccaagaggaattaa

DBGET integrated database retrieval system