KEGG   Cryptococcus neoformans B-3501A: CNBM0810Help
Entry
CNBM0810          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CNBM0810
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CNBM0810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 637 aa AA seqDB search
MSIITTAFALSLLATTAFAVPPETPRIELQAERGLGDQSYAPWQVDCPSNVTWIRNATTG
LGTGERAYIEAREKLVQPAIEQMMAARGLETPPRTPVIGVALAGGGYRAMLTGLGGIMGM
MNESTEASQSETGGWLDGVSYWSGLSGGSWATGSFMSNGGQLPTTLLENLWNIDSNLVFP
DDGKLSFYTNLYTETNAKSDLGFPVQITDIWGLAIGSHVLPEPYQLSNTPNLTFSSLPSV
VAALGNASLPMPIIVAADRKRREAGELVIAENATVWEFTPYEFGSWAFGSQYKSPGAFTP
IEYLGTSVDDGSPNGTCWKGFDQLSFVMGTSATLFNGAFLELNGTDSGLLTNLITAFLAD
LGEDQADISRIPNSFSNYNSGENPIYNLTYITLVDAGETNQNIPLEPLLVPTRDVDAIVA
FDSSYDSDYIWPNGTALRTTYERAKILAEHENTRVLMPEVPSMNGFVNGGYNSRPTFFGC
NDTTTPVIIYIPSYPWSFAANTSTYQLSYENNEANEMLLNGMRSLTLNHSVPTWPTCFAC
ALTDRSFMYTSENRSTTCQECFDTWCWAGDDNTTEPANYEPVINSVPPWLIANNLSIGMA
DAPGSNESTAGTASSGAAKMGVGMGMVALTAGLGLML
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcatcacgaccgctttcgcgctctcacttctcgccaccactgctttcgctgtt
cctccagagactccgcggattgagcttcaggcggagagaggtttgggtgatcaatcctat
gctccttggcaagtcgattgcccctccaacgttacttggattagaaatgccactactggt
ttaggtaccggcgaacgagcctatattgaggctcgtgaaaaacttgtccaacctgcgatc
gagcagatgatggctgctcgagggctcgaaactcctccccggacacctgtcatcggtgtc
gccttggccggtggtggttaccgtgcaatgcttacagggttgggtggtatcatgggcatg
atgaatgagagtacggaagcgtcccaaagcgagactggtggttggcttgacggcgtaagc
tactggtctggtctgagcggtggaagttgggcaactgggtctttcatgtcgaatgggggt
cagttgcccacaactcttcttgaaaacctctggaacatcgattccaatctcgtctttcca
gatgacggcaaactttcattctacactaatctttacactgagaccaacgccaaatcagac
ctcggtttcccagttcaaattactgatatttggggtcttgccattggctcccacgtttta
cccgagccttaccagctctccaacactcctaatctcactttttctagccttccctctgtc
gtcgctgccttgggcaacgcaagcttgcccatgcccatcattgtcgcagctgaccggaaa
agacgagaggctggagagcttgtcattgccgaaaatgcaactgtctgggagtttactcca
tacgagtttggttcttgggcttttggtagccaatacaagagccctggtgctttcacccct
attgaatatctcggtacttcagtggacgatggctcacctaacggtacctgttggaagggc
tttgaccagttgtcctttgtcatgggaacttctgcgactcttttcaatggtgcctttctc
gaacttaacggcacagacagcggtcttcttaccaatttaatcactgccttccttgcggat
ctgggagaggaccaagctgatatttcccgtatccccaatagtttctccaattacaactcg
ggggagaaccccatctacaacctcacttacatcaccctcgtcgatgccggagaaaccaac
cagaacatacccctcgaacctttgctcgttcccacccgtgatgttgacgcgattgtggca
tttgactcttcctacgattctgactatatttggccaaacggcactgctttgaggactacc
tacgagcgagccaagattttagctgagcacgagaacacaagggtgttaatgcccgaggtc
cctagcatgaacggctttgtcaatggtggttacaactcaaggcctactttctttggctgt
aacgataccaccactcctgtgatcatctacataccttcttacccatggagctttgctgcc
aatacttctacttaccaactttcgtacgagaataatgaagccaacgaaatgttgctcaac
ggtatgcgctctctcactctcaaccactctgtccccacctggcccacttgctttgcttgt
gctcttaccgaccgctccttcatgtacacctccgagaaccgatccaccacctgtcaagag
tgttttgacacttggtgttgggctggtgacgacaacaccaccgagcctgcgaattatgag
cctgtaatcaacagtgttccgccctggttgatcgccaacaacctgagtatcggcatggcc
gatgctcctgggagcaacgaatccactgctggcacagcgtccagtggtgcagcgaagatg
ggtgtgggcatgggtatggtcgctctcactgctggtttgggcttgatgctttag

DBGET integrated database retrieval system