KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBM2250Help
Entry
CNBM2250          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CNBM2250
Enzymes [BR:cnb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CNBM2250
Chaperones and folding catalysts [BR:cnb03110]
 Protein folding catalysts
  Protein disulfide isomerase
   CNBM2250
Membrane trafficking [BR:cnb04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    CNBM2250
Exosome [BR:cnb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CNBM2250
  Exosomal proteins of colorectal cancer cells
   CNBM2250
  Exosomal proteins of bladder cancer cells
   CNBM2250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_8 Thioredoxin_7 Thioredoxin_2 AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 4939587
NCBI-ProteinID: XP_772068
UniProt: F5HCM7
Position
13
AA seq 492 aa AA seqDB search
MKFSSKLSLALVAALPNLASVLASDVLDLTESTFQKEIAGEDLALVEFFAPWCGHCKNLA
PHYEEAATELKEKNIKLAKVDCTVEQGLCGEFGVNGYPTLKVFRNGSPTDYAGTRKADGI
ISYMTKQSLPAISDVTPESHDTFIKSDNVVLVAYGDDAHPVPEAFKQYAKGARDSYLFGQ
YLSNDLPSIPENPSLPAIVLYKDFDEGYAVFPSGEIAHADVDELSEFVKQNSIPLFDEIS
PENFGSYAEQGIPIAYLFVDPNEASAREKLVEELKPLAKELKGIVNFVYIDAIKFIDHGK
SLNLPGDSWPAFVIQDLADQTKFPLTSKATAENIKDFVKKYVVGEISPSIKSEPIPATQG
PVYKLVADDWDNVYGDESKDVFAEFYAPWCGHCQRLAPIWDTLGEKYAGNNNIIIAQMDA
TENDIPPSAPFRVQGFPTLKFRPAGSSEFIDYTGDRSLDSLVEFVETNRKSDADVAEEEW
EDEDETPEHDEL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctcttcaaagctctccctcgccctcgtggccgccctccccaacctcgcctcc
gtcttggccagcgacgtcctcgatttgaccgagtctaccttccagaaggagattgccggt
gaagacttggctttggttgagttctttgctccttggtgcggtcactgtaagaaccttgca
ccccactacgaggaagccgctaccgagctcaaagagaagaatatcaagcttgccaaggtc
gactgtaccgttgagcaaggtctttgcggcgagtttggtgtgaatggatacccaacgttg
aaggtgtttaggaacggttcccctaccgactatgctggtaccaggaaagccgacggtatc
attagctacatgactaagcagagcctccccgccattagcgatgtaacccctgagtctcat
gacacgtttatcaagtctgacaatgttgtcctcgttgcctacggtgacgatgcccatcct
gtccctgaagccttcaagcagtacgccaagggcgcccgagactcatacctcttcggccaa
tacctttccaacgaccttccttctatccccgagaacccctctcttcccgctattgtcctc
tataaggactttgacgaaggttatgcagtcttcccgtctggcgagatcgcccatgccgat
gttgacgagctcagcgagtttgtcaagcaaaactccatccctctctttgacgaaatctct
cccgaaaactttggctcttatgccgaacagggtatccccatcgcatacctctttgtcgac
cccaacgaggcttctgcccgtgaaaagcttgtcgaggaactcaagccccttgccaaagag
ctcaagggtattgtcaactttgtttacattgacgctatcaagtttatcgaccatggcaag
tctctcaacctcccaggtgactcttggcctgcctttgtgattcaagaccttgccgaccag
accaaattccctttgaccagcaaggccaccgctgaaaatattaaggactttgtcaagaag
tacgttgtcggtgagatttctcctagcatcaagtctgagcctattccggccacccaaggt
cctgtttacaagcttgttgccgacgactgggacaacgtttacggcgatgagtccaaggat
gtttttgccgagttttacgctccttggtgcggtcattgccaacgtttggctcccatctgg
gacactctcggtgagaagtacgccggtaacaacaacatcatcattgcccaaatggacgcc
accgagaatgacattcccccttctgcccccttccgagtccaaggcttcccgaccctcaaa
ttccgacctgccggttcttctgaattcattgattacactggcgacaggagcctcgacagc
cttgttgagtttgtagagactaacaggaagagcgatgctgatgtcgccgaggaggagtgg
gaggatgaggacgagactcctgagcacgatgagttgtag

DBGET integrated database retrieval system