KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBN1180Help
Entry
CNBN1180          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb03022  Basal transcription factors
cnb03420  Nucleotide excision repair
Module
cnb_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CNBN1180
  Replication and repair
   03420 Nucleotide excision repair
    CNBN1180
Transcription machinery [BR:cnb03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CNBN1180
DNA repair and recombination proteins [BR:cnb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CNBN1180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 DUF2513
Motif
Other DBs
NCBI-GeneID: 4939727
NCBI-ProteinID: XP_771938
UniProt: Q55HK2
Position
14
AA seq 481 aa AA seqDB search
MVQPFVSAPKKDATKQASPTLALDIFLDNQHQSYFEELYRLLPPVCRQIILHALWSHHPL
RTVDVKLLLQMDVHAPLEECDEVMRPAIDRKVLHPMHYKKQRMQWSLNDSFKKGLRNALT
GLGTSNSFGVPFERHQATDLDLPSEDELVAYGEDTFESILKYMVSSGLGTEFSGSRPQPE
VLQLLHTSGLMTDSVDMNGRNPNINRLTITSKGFQFLLEKRQTQLWEILMYYLSAKEANS
ERSSEVLSMFFSLGCMQLGQDYSASNSFPGAQEALDDLAQYGFIYKSSPDSDQFWPTHLA
TSLCSGDASAIQSQSADDKRFLILETNYKIYAYTSNELEIAILNLFVDIRIRYPNLVVGK
LDRQHVKAAMEKGISARQIIAYLSSHAHPQMYNSPPPLLHPTIVDQLYLWDRERNRLQTE
ETVMYEFFSKELFDDTVNEAKANAALQHAATSQKLLFIEPHTKPAITEFVKQRQNVLRGG
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaccattcgtttcagctcccaagaaggatgcgaccaaacaggcatcgccgaca
ttggctcttgacatctttctcgataaccagcaccagtcgtattttgaggagctctacaga
ttactaccgccagtatgccgtcaaattattctccatgccttgtggtcccatcatccatta
cggacggtcgatgtcaagctgcttctccagatggatgtccatgctcctttagaagaatgc
gacgaggtcatgcgaccagctatagacaggaaggtcctccatccaatgcattataagaaa
cagagaatgcagtggtccttgaatgattctttcaagaagggcctgagaaatgccttgaca
ggattaggaacatcaaattcgttcggtgtaccctttgaaagacatcaggcaactgacctt
gatcttccctccgaggacgagctcgtggcgtatggcgaggatacgtttgagtctattctc
aaatacatggtgtcttccggtctcggtacagaattctctggatccagaccacagcctgag
gtcctccagctcttacataccagcggcctcatgacagactctgtcgatatgaacggaaga
aatcccaatataaatcggctcacaatcacttccaaaggctttcaatttttgctcgagaag
agacagactcagttgtgggagatactcatgtactacttgagtgccaaagaagcaaactct
gaacggtcatccgaggtcttgtcaatgttcttctccctcggatgtatgcaactaggacaa
gactattccgcgtccaactccttccctggcgctcaagaagctctcgacgatctcgcccaa
tacggtttcatttacaaatcatcgcctgacagcgatcaattttggcccacccaccttgcc
acctctttgtgttccggcgacgcttccgccatccaatctcagagtgcagacgacaagcgt
ttcctaatattggaaaccaattacaaaatttacgcatatacttcaaacgagctcgagatc
gctatccttaatctctttgtcgacattcgcattcggtaccccaacctcgttgtaggaaaa
ctcgaccgtcagcacgttaaagccgccatggaaaagggtatctcagcccgacagatcatc
gcctatttgtccagtcatgcccatccacaaatgtacaactctcccccaccattattacat
cccaccattgtcgatcaactttatttatgggatcgagagaggaatagattacagacggaa
gagaccgttatgtacgaattcttcagcaaagaactctttgacgatactgtcaatgaagcc
aaagcgaatgcggctctacagcatgccgctacatctcaaaaactattattcatcgagcca
catacgaagcctgcgatcacagaattcgtcaaacaaagacagaacgtccttagagggggt
tattag

DBGET integrated database retrieval system