KEGG   Cryptococcus neoformans B-3501A: CNBN1180Help
Entry
CNBN1180          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:cnb03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cnb03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 481 aa AA seqDB search
MVQPFVSAPKKDATKQASPTLALDIFLDNQHQSYFEELYRLLPPVCRQIILHALWSHHPL
RTVDVKLLLQMDVHAPLEECDEVMRPAIDRKVLHPMHYKKQRMQWSLNDSFKKGLRNALT
GLGTSNSFGVPFERHQATDLDLPSEDELVAYGEDTFESILKYMVSSGLGTEFSGSRPQPE
VLQLLHTSGLMTDSVDMNGRNPNINRLTITSKGFQFLLEKRQTQLWEILMYYLSAKEANS
ERSSEVLSMFFSLGCMQLGQDYSASNSFPGAQEALDDLAQYGFIYKSSPDSDQFWPTHLA
TSLCSGDASAIQSQSADDKRFLILETNYKIYAYTSNELEIAILNLFVDIRIRYPNLVVGK
LDRQHVKAAMEKGISARQIIAYLSSHAHPQMYNSPPPLLHPTIVDQLYLWDRERNRLQTE
ETVMYEFFSKELFDDTVNEAKANAALQHAATSQKLLFIEPHTKPAITEFVKQRQNVLRGG
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaccattcgtttcagctcccaagaaggatgcgaccaaacaggcatcgccgaca
ttggctcttgacatctttctcgataaccagcaccagtcgtattttgaggagctctacaga
ttactaccgccagtatgccgtcaaattattctccatgccttgtggtcccatcatccatta
cggacggtcgatgtcaagctgcttctccagatggatgtccatgctcctttagaagaatgc
gacgaggtcatgcgaccagctatagacaggaaggtcctccatccaatgcattataagaaa
cagagaatgcagtggtccttgaatgattctttcaagaagggcctgagaaatgccttgaca
ggattaggaacatcaaattcgttcggtgtaccctttgaaagacatcaggcaactgacctt
gatcttccctccgaggacgagctcgtggcgtatggcgaggatacgtttgagtctattctc
aaatacatggtgtcttccggtctcggtacagaattctctggatccagaccacagcctgag
gtcctccagctcttacataccagcggcctcatgacagactctgtcgatatgaacggaaga
aatcccaatataaatcggctcacaatcacttccaaaggctttcaatttttgctcgagaag
agacagactcagttgtgggagatactcatgtactacttgagtgccaaagaagcaaactct
gaacggtcatccgaggtcttgtcaatgttcttctccctcggatgtatgcaactaggacaa
gactattccgcgtccaactccttccctggcgctcaagaagctctcgacgatctcgcccaa
tacggtttcatttacaaatcatcgcctgacagcgatcaattttggcccacccaccttgcc
acctctttgtgttccggcgacgcttccgccatccaatctcagagtgcagacgacaagcgt
ttcctaatattggaaaccaattacaaaatttacgcatatacttcaaacgagctcgagatc
gctatccttaatctctttgtcgacattcgcattcggtaccccaacctcgttgtaggaaaa
ctcgaccgtcagcacgttaaagccgccatggaaaagggtatctcagcccgacagatcatc
gcctatttgtccagtcatgcccatccacaaatgtacaactctcccccaccattattacat
cccaccattgtcgatcaactttatttatgggatcgagagaggaatagattacagacggaa
gagaccgttatgtacgaattcttcagcaaagaactctttgacgatactgtcaatgaagcc
aaagcgaatgcggctctacagcatgccgctacatctcaaaaactattattcatcgagcca
catacgaagcctgcgatcacagaattcgtcaaacaaagacagaacgtccttagagggggt
tattag

DBGET integrated database retrieval system