KEGG   Cupriavidus necator: CNE_1c00610Help
Entry
CNE_1c00610       CDS       T01564                                 

Gene name
gpwA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cnc  Cupriavidus necator N-1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CNE_1c00610 (gpwA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CNE_1c00610 (gpwA)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CNE_1c00610 (gpwA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:64215..64859
Genome map
AA seq 214 aa AA seqDB search
MTRRFPSSATLRQLRPAALAGALALAAAGAALLPHPARAADKPAAAPAPQATGACPASLN
FKFPRLQDEAPQNLCQYAGKVVLVVNTASYCGFTPQYEGLEALYSKYRDRGLVVLGFPSN
DFSQEPGSEKQIADFCYNTYGVKFPMLGKSHVRGSEANPMYALLAKETGTAPKWNFYKYL
IGRNGQVVGSYNSKTTPDDKKFVAKIEELLASPR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtcgtttcccctcgtccgccacactccgacaactgcgcccggccgccctcgcc
ggcgcgctggcgctggccgcagccggcgccgcgctattgccgcaccctgcccgcgccgcc
gacaagccggccgccgcgcctgcaccgcaggcaacaggcgcctgcccggcgtcgctcaac
ttcaagttcccgcgcctgcaggatgaagccccgcaaaacctctgccagtacgcgggcaag
gtcgtgctggtggtcaacaccgccagctactgcggcttcacgccccagtacgaagggctg
gaggcgctctacagcaagtaccgtgaccgcggcctggtcgtgctgggcttcccgtcgaac
gatttctcgcaggagcccggctcggagaagcagatcgcggacttctgctacaacacctac
ggcgtcaagttcccgatgctgggcaagtcgcacgtgcgcggcagcgaggccaacccgatg
tacgcgctgctggcgaaggaaaccggcaccgcgcccaagtggaacttctacaaatacctg
atcggccgcaacggccaggtggtgggcagctacaacagcaagaccacgcctgacgacaag
aagttcgtcgccaagatcgaagaactgctggccagcccgcgctga

DBGET integrated database retrieval system