KEGG   Cupriavidus necator N-1: CNE_1c01610Help
Entry
CNE_1c01610       CDS       T01564                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase ThlA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cnc  Cupriavidus necator N-1
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNE_1c01610 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    CNE_1c01610 (thlA)
   00640 Propanoate metabolism
    CNE_1c01610 (thlA)
   00650 Butanoate metabolism
    CNE_1c01610 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    CNE_1c01610 (thlA)
   00072 Synthesis and degradation of ketone bodies
    CNE_1c01610 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNE_1c01610 (thlA)
   00310 Lysine degradation
    CNE_1c01610 (thlA)
   00380 Tryptophan metabolism
    CNE_1c01610 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CNE_1c01610 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CNE_1c01610 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CNE_1c01610 (thlA)
Enzymes [BR:cnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CNE_1c01610 (thlA)
Exosome [BR:cnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CNE_1c01610 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:160654..161832
Genome map
AA seq 392 aa AA seqDB search
MEEIVIVSAARTPMAAFQGEFASVTAPQLGAVAIRAAVERAGLKPEQVEEVVFGCVLPAG
QGQAPARQAALGAGLPLGVGCTTVNKMCGSGMRAAMTVYDGLIAGSFDIAIAGGMESMTN
APYLVPKGRGGYRIGHGMIYDHMMLDGLEDAYDKGRAMGTFGEDCAAKYGFTREQQDEFA
MESVRRAQQATENGDFRWEIAPVTVSGKGGDTVIDTDEGPRRIKLDKIPSLKPAFAKDGT
ITAASSSSINDGASALVMMRASTAKKLGLQPIARMLGHTTHAQAPGWFTTAPVEAIAKLY
RKLDWTTDSVDLFEINEAFAVVPMAAMHDLKIARDKVNIHGGACALGHPIGASGARIMTT
LIGALRKTGGKRGVASLCIGGGEATAVGIEIL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagagatcgttatcgtttcagccgcccgcacgccgatggctgcgttccagggcgaa
ttcgccagcgtcaccgcgccgcagctgggcgccgtggccatccgcgccgccgttgagcgc
gccggcctgaagcccgagcaggtggaagaagtggtgttcggctgcgtgctgccggccggc
cagggccaggccccggcgcgccaggccgcgctgggcgccggcctgccgctgggcgtgggc
tgcaccaccgtcaacaagatgtgcggctcgggcatgcgcgcggccatgaccgtctacgac
gggctgatcgcgggctcgttcgacatcgccattgccggcggcatggagagcatgaccaat
gcgccgtacctggtgccgaagggccgtggcggctaccgcatcggccacggcatgatctac
gaccacatgatgctggacggcctggaagacgcgtatgacaagggccgcgccatgggcacc
ttcggcgaggattgcgccgccaagtacggctttacgcgcgagcagcaggacgaattcgcg
atggaaagcgtgcgccgcgcccagcaggccaccgagaacggcgacttccgctgggagatt
gcgccagtgaccgtgtccggcaagggcggcgacaccgtgatcgacaccgacgaaggcccg
cgccgcatcaagctcgacaagatcccctcgctcaagcccgcctttgccaaggacggcact
atcaccgcggcctcgtcgtcgtccatcaacgacggcgcctcggcgctggtgatgatgcgc
gcctccaccgcgaagaagctcggcctgcagccgatcgcacgcatgctcggccacaccacc
cacgcgcaggcgccgggctggttcaccaccgcgccggtcgaggccatcgccaagctgtac
cgcaagctggactggaccaccgacagcgtcgacctgttcgagatcaacgaggcctttgcc
gtggtgccgatggcggccatgcacgacctcaagatcgcgcgcgacaaggtcaatatccac
ggcggcgcctgcgcgctgggccacccgatcggcgcctcgggcgcacgcatcatgaccacg
ctgatcggcgcgctgcgcaagaccggcggcaagcgcggcgtggcgagcctgtgcattggc
ggcggcgaggcaaccgcggtcggtattgagattctctga

DBGET integrated database retrieval system