KEGG   Cupriavidus necator: CNE_1c03480Help
Entry
CNE_1c03480       CDS       T01564                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cnc  Cupriavidus necator
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cnc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cnc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cnc00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:cnc00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cnc00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(346489..347235)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWVDVDLTETGADQARQAGKLLKDAGLGFDVAYTSVLKR
AIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKAETAAKFGDEQVLVWRRSYDTP
PPALEPTDPRASYDDPRYANVPRNEIPLTECLKDTVARVMPLWNESIAPDIQSGKRVVIA
AHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDADLRPLRHYYLGDQDAIAASLAA
VASQGKAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgtcctcatccgccacggcgaatccacgtggaaccttgaaaaccgcttt
accggctgggtcgacgtcgacctgaccgaaaccggcgccgaccaggcgcgccaggccggc
aagctgctcaaggatgccggcctgggctttgacgtggcctatacctcggtgctcaagcgc
gccatccgcacgctgtggcatgtgcaggatgaaatggacctgatgtggatcccggtgcgc
aacgaatggcgcctgaacgagcgccactacggcgcgctggccggcctgaacaaggcagaa
accgccgccaagttcggcgacgagcaggtgctggtgtggcgccgcagctatgacacgccg
ccgcccgcactggagcccaccgatccgcgtgcctcgtacgacgatccgcgctacgccaat
gtgccgcgcaacgagatcccactgaccgagtgcctgaaggacaccgtggcccgcgtgatg
ccgctgtggaacgaatccatcgcccccgacatccaatccggcaagcgcgtggtcattgcc
gcccatggcaacagcatccgcgcgctggtgaaatacctggaccagatctcggatgacgat
atcgtcggactcaatatccccaacggcaccccgctcgtctatgagctggacgccgacctg
cgccccctgcgccactactacctgggtgaccaggacgccatcgccgcctcgctggcggcc
gtggccagccagggcaaggcacgctga

DBGET integrated database retrieval system