KEGG   Cupriavidus necator: CNE_1c05200Help
Entry
CNE_1c05200       CDS       T01564                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cnc  Cupriavidus necator
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cnc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(522715..523296)
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGTLIEKNPPHLLVDCHGVGYEVDVPMSTFYNLPAVGQPVTLLTQLIVREDAHLL
YGFGTASERNTFRELIKITGIGARMALAVLSGMSVPELAQAITLQEAGRLTRIPGIGKKT
AERLLLELKGKLGAELGHAPGTPAVPDSAVDVLNALLALGYSEKEAAAAIKQVPAGTGVS
EGIKLALKALSKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcatcgccggcacccttatcgagaagaatcccccgcacctgctggtcgat
tgccacggcgtcggctacgaggtggacgtgccgatgagcaccttctacaacctgcccgcg
gtgggccagccggtgacgctgctgacgcagctgatcgtgcgcgaggacgcgcacctgctg
tacggcttcggcaccgcatcggaacgcaacacctttcgcgagctgatcaagatcaccggc
atcggcgcgcgcatggcgctggcggtgctgtcgggcatgtcggtccccgagctggcgcag
gccatcacgctgcaggaagccggccgcctcacgcgcattcccggcatcggcaagaagacc
gcggagcggctgctgctggagctcaagggcaagctgggcgcggagctgggccatgcgccg
ggcacgccggcggtgccggacagcgccgtcgacgtgctcaatgcgctgctggcgctgggc
tactcggagaaggaagccgccgcggcgatcaagcaggtgccggcggggaccggcgtgtcg
gagggcatcaagctggcgctcaaggcattgtccaagggttga

DBGET integrated database retrieval system