KEGG   Cupriavidus necator N-1: CNE_1c09900Help
Entry
CNE_1c09900       CDS       T01564                                 

Gene name
tpiA
Definition
triosephosphate isomerase TpiA (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNE_1c09900 (tpiA)
   01230 Biosynthesis of amino acids
    CNE_1c09900 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_1c09900 (tpiA)
   00051 Fructose and mannose metabolism
    CNE_1c09900 (tpiA)
   00562 Inositol phosphate metabolism
    CNE_1c09900 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CNE_1c09900 (tpiA)
Enzymes [BR:cnc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CNE_1c09900 (tpiA)
Exosome [BR:cnc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CNE_1c09900 (tpiA)
  Exosomal proteins of bladder cancer cells
   CNE_1c09900 (tpiA)
  Exosomal proteins of melanoma cells
   CNE_1c09900 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1016049..1016786
Genome map
AA seq 245 aa AA seqDB search
MRQKLVIGNWKMHGSLAANAALLEGIKAGAAKATLAVCAPFPYLAQCQALLNGSQVAWGA
QDVSAEARGAFTGEVAASMVGEFGCTYVLVGHSERRTYHGETDQTVAAKALRALEFGIVP
VVCVGETLAQREAGETEAVVGRQLQAVLDALTVEQLSRVVLAYEPVWAIGTGKTATSEQA
QAVHAFLRGQVVARDAGVAERMAILYGGSVKPDNAAELFSMTDIDGGLIGGASLKSEDFL
AIGNA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaaagctcgtcatcggcaattggaagatgcacggcagcctggctgcaaacgcg
gcgctgctggagggtatcaaggctggcgcggccaaggcgacgctggcggtctgcgcgccg
ttcccctatcttgcacaatgccaggcgttgctgaatggctcgcaggtggcctggggcgca
caagatgtgtcggcggaggcgcgtggcgccttcaccggtgaagtcgcggcatcgatggtc
ggtgaatttggttgcacttatgtgctggtcggccactcggagcgccgcacctatcatggc
gaaaccgaccagaccgtcgcggccaaggcgctgcgcgcgctggaattcggcatcgtcccg
gtggtctgcgtgggtgaaacgctggcccagcgcgaggcgggcgaaaccgaggcggtggtc
ggcaggcaactgcaggccgtgctggacgcgctgacggtggagcagctgagccgcgtggtg
ctggcctatgagccggtctgggcgatcggcaccggcaagaccgccaccagcgaacaggcg
caggcggtgcacgcgttcctgcgcggccaggttgttgcgcgcgatgcgggcgtggccgag
cgcatggccatcctgtacggcggcagcgtcaagccggacaatgcggccgaactgttttcc
atgaccgatatcgacgggggcctgattggcggcgcctcgctgaagtcggaagattttctc
gcgatcggcaacgcctga

DBGET integrated database retrieval system