KEGG   Cupriavidus necator N-1: CNE_1c11450Help
Entry
CNE_1c11450       CDS       T01564                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00010  Glycolysis / Gluconeogenesis
cnc00620  Pyruvate metabolism
cnc00640  Propanoate metabolism
cnc00680  Methane metabolism
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
cnc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_1c11450
   00620 Pyruvate metabolism
    CNE_1c11450
   00640 Propanoate metabolism
    CNE_1c11450
  Energy metabolism
   00680 Methane metabolism
    CNE_1c11450
Enzymes [BR:cnc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CNE_1c11450
Lipid biosynthesis proteins [BR:cnc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CNE_1c11450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEI76500
UniProt: G0F122
Position
1:complement(1175237..1176967)
Genome map
AA seq 576 aa AA seqDB search
MAAAALPASRRDDYRALYESFRWEIPPHFNIAEACCGRWARDPATMDRIAVYTEHEDGRR
NAHAFAHIQAEANRLSAALRALGVARGDRVAIVMPQRIETVIAHMAIYQLGAIAMPLSML
FGPEALAYRIAHSEANVAIADETSIDNVLAARPECPTLATVIAAGGAHGRGDHDWDVLLA
AQLPVFTAEQTKADEAAVLIYTSGTTGPPKGALIPHRALIGNLTGFVCSQNWYPRDDDVF
WSPADWAWTGGLWDALMPALYFGKPIVGYQGRFSAERAFELLERYAVTNTFLFPTALKQM
MKACPEPRQRYDIRLRALMSAGEAVGETVFGWCRDALGVIVNEMFGQTEINYIVGNCTAQ
NDDNQLGWPARPGSMGRPYPGHRVQVIDDEGHPCPPGEDGEVAVCATDSAGHPDPVFFLG
YWKNEAATAGKYTERDGLRWCRTGDLARVDADGYLWYQGRADDVFKSSGYRIGPSEIENC
LLKHPAVSNCAVVPSPDPERGAVVKAFVVLTPSVARSFDGDAALVTELQAHVRGQLAPYE
YPKAIEFIDQLPMTTTGKIQRRVLRLLEEERAGKRA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagctgccttgccggcaagccggcgcgacgactatcgcgccctgtatgaatcc
ttccgctgggaaattcccccgcatttcaatatcgccgaggcctgctgcgggcgctgggcg
cgcgacccggccacgatggaccgcatcgcggtctataccgagcacgaggacggccgccgc
aacgcgcatgcctttgcccatatccaggccgaagccaaccgcctgtcggcggcgctgcgc
gcactgggcgtggcgcgcggcgaccgcgtggcaatcgtgatgccgcagcggatcgagacc
gtgatcgcgcatatggcgatctaccagctcggcgccatcgccatgccgctgtcgatgctg
ttcgggcccgaggcgctggcctaccgcatcgcacacagcgaagccaacgtggcgatcgcc
gacgagacttccatcgacaatgtgctggccgcgcgcccggaatgcccgacgctggccacc
gtgattgccgccggcggcgcgcatggccgcggcgaccacgactgggacgtgctgctggcc
gcgcagttgcccgtctttaccgccgagcagaccaaggctgacgaagccgccgtgctgatc
tacaccagcggcaccaccggtccgcccaagggcgcgctgatcccgcaccgcgcgctgatc
ggcaacctgaccggctttgtctgctcgcagaactggtatccgcgggacgacgacgtgttc
tggagccccgctgactgggcctggaccggcggcctgtgggatgcgctgatgccggcgctg
tatttcggcaaacccatcgtcggctaccagggacgcttctccgccgagcgcgccttcgag
ctgctggagcgctacgccgtcaccaacaccttcctgttcccgaccgcgctcaagcagatg
atgaaggcctgccccgagccgcggcagcgctacgacatcaggctgcgtgcgctgatgagc
gccggcgaggccgtgggcgagaccgtgttcggctggtgccgcgatgcgctgggcgtgatc
gtcaacgagatgttcggccagaccgagatcaactacatcgtcggcaactgcaccgcgcag
aacgacgacaaccagctgggctggccggcacggccgggctcgatggggcgcccctatccg
ggccaccgcgtgcaggtgatcgacgacgaaggccacccctgcccgcccggcgaagacggc
gaggtggcggtgtgcgccaccgacagcgccgggcatccggacccggtgttcttcctcggc
tactggaagaacgaggccgccaccgcgggcaagtacaccgagcgcgacggcctgcgctgg
tgtcgcaccggcgacctggcgcgcgtcgatgccgatggctacctgtggtaccaggggcgt
gccgacgatgtgttcaagtcctcgggctaccgcatcgggccgagcgagatcgagaactgc
ctgctcaagcatccggcagtgtccaactgcgccgtggtgccctcgcccgaccccgagcgc
ggcgccgtggtcaaggccttcgtggtgctgacgccgtcggtggcgcgctcgttcgacggc
gacgcagcgctggtcacagagctgcaggcgcatgtgcgcggccagctggcgccgtatgaa
tacccgaaggcaattgagttcatcgaccagttgccgatgaccaccaccggcaagatccag
cggcgcgtgctgcgcctgctggaggaagagcgcgcgggcaagcgcgcctag

DBGET integrated database retrieval system