KEGG   Cupriavidus necator N-1: CNE_1c13250Help
Entry
CNE_1c13250       CDS       T01564                                 

Gene name
hbdH
Definition
D-beta-hydroxybutyrate dehydrogenase HbdH (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cnc  Cupriavidus necator N-1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CNE_1c13250 (hbdH)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CNE_1c13250 (hbdH)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     CNE_1c13250 (hbdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1349903..1350679)
Genome map
AA seq 258 aa AA seqDB search
MLNGKTALVTGSTSGIGLGIAKALAAQGANIIVNGFGDADAAKAEIAQAGQGIRVGYHGA
DMSKAAEIEDMMRYAQSDFGGADILINNAGIQHVAAIEDFPPERWDAIIAINLTSAFHTT
RLALPGMKQKDWGRIINVASTHGLVASAQKSAYVASKHGIVGFTKVTALETAQTGVTANA
ICPGWVLTPLVQKQVEARAQKEGIPVEQAKRELVLEKQPSGQFVTPDELGALAVFLSSEA
ARQVRGAIWNMDGGWVAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacggcaagaccgcactggtgactggctcgaccagcggcatcgggctcggcatc
gcgaaagcgctggcggcccagggcgctaacatcatcgtcaacggctttggtgacgcggac
gccgcaaaggcagagatcgcgcaggccggccagggaatccgggtcggctaccacggcgcc
gacatgagcaaggcggccgagatcgaggacatgatgcgctacgcgcagtccgacttcggt
ggcgccgacatcctgatcaacaacgccggcatccagcacgtggccgccatcgaggatttc
ccgcccgagcgctgggacgcgatcatcgccatcaacctgacctcggccttccacacgacg
cgcctggcgctgcccggcatgaagcagaaggactggggccgcatcatcaatgttgcctcc
acccacgggctggtggcctcggcgcagaagtccgcctatgtggcgtccaagcacggcatc
gtcggcttcactaaggtgaccgcgctggaaaccgcgcagaccggtgtcaccgccaacgcg
atctgcccgggctgggtgctgacgccactggtgcagaagcaggtcgaagcccgcgcgcag
aaggaaggcattccggtggaacaggccaagcgcgagctggtgctggagaagcagccctcg
ggacagtttgtcacgcccgatgaactgggcgcgctggccgtgttcctgtcgtccgaagcg
gcccgccaggtccgcggagcgatctggaacatggacggcggctgggtggcgcagtaa

DBGET integrated database retrieval system