KEGG   Cupriavidus necator N-1: CNE_1c14020Help
Entry
CNE_1c14020       CDS       T01564                                 

Gene name
pdhB
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00010  Glycolysis / Gluconeogenesis
cnc00020  Citrate cycle (TCA cycle)
cnc00620  Pyruvate metabolism
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
cnc01200  Carbon metabolism
Module
cnc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_1c14020 (pdhB)
   00020 Citrate cycle (TCA cycle)
    CNE_1c14020 (pdhB)
   00620 Pyruvate metabolism
    CNE_1c14020 (pdhB)
Enzymes [BR:cnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CNE_1c14020 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 DUF4813 HlyD_3 DEC-1_N FAP
Motif
Other DBs
NCBI-ProteinID: AEI76749
UniProt: G0ESV2
Position
1:1412375..1414051
Genome map
AA seq 558 aa AA seqDB search
MSQAIEIKVPDIGDYDAVPVIEVHVKPGDSIDAEDALVTLESDKATMDVPSPQGGVVKEV
RIKVGDNVAEGSVLVMLEPAGQAAAAPAPAAAPAPAAAAPAPAAAAAPAAPAPAPAAAPA
GGGGIIEVKVPDIGDYDAVPVIEVHVKAGDTINAEDAVVTLESDKATMDVPSPQGGVVKE
VKVKVGDNVAEGTLLLILEGAAAAAAPAAAAAAPAPAPAASAPAPAPAPAAAAPAPAAAP
AAAPAAAGAIGKAAHASPSVRKFARELGVDVSRVPGTGPKGRITQEDVQGYVKGVMSGQA
AAPAQAAAAGAGGGELGLLPWPKVDFTRFGEVESKALSRIKKISGANLHRNWVMIPHVTN
HDEADITELEAFRVQLNKENEKAGIKVTMLAFMIKATVAALKKFPNFNASLDGDNLVLKK
YFNVGFAADTPNGLVVPVIKDADKKGVLEISQEMNELAKLARDGKLKPDQMQGGCFSISS
LGGIGGTYFTPIINAPEVAIMGVCKSYQKPVWDGKQFVPRLTLPLSLSWDHRVIDGAEAA
RFNTYFGQLLADFRRILL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgattgaaatcaaggtgccggatatcggcgactatgacgccgttcccgtc
attgaagtgcatgtgaaacccggcgacagcatcgacgcggaagacgcgctggtgacgctg
gagtcggacaaggccaccatggacgtgccctcgccgcagggcggcgtggtcaaggaagtc
aggatcaaggttggcgacaacgtcgccgaaggctcggtgctggtgatgctggagccggcc
ggccaggccgctgctgcgcccgcgcctgcagccgcaccggcgcctgccgccgctgcaccg
gccccggcagccgccgcagcccccgcagcccccgcgccggctccggccgcagcgccggct
ggcggtggcggcatcatcgaggtgaaggtgcctgatatcggcgactacgacgccgtgccg
gtcatcgaagttcacgtcaaggcgggcgacaccatcaatgccgaagacgccgtggtgacg
ctggagtccgacaaggccaccatggacgtgccgtcgccgcaaggcggcgtggtcaaggaa
gtcaaggtcaaggtcggtgacaacgtcgccgaaggcacgctgctgctgatcctggaaggc
gccgccgcagccgccgccccggccgctgccgccgcggcaccggctccggctccggctgcc
agcgcgcccgcaccggcgccggcccccgcagccgccgccccggctccggccgcagcgcct
gctgccgcgccggccgccgctggcgcaatcggcaaggccgcccacgccagcccctcggtg
cgcaagttcgcacgcgagctgggcgtggacgtgtcgcgcgtgccgggtaccggccccaag
ggccgtatcacccaggaagacgtgcagggctacgtcaagggcgtgatgagcggccaggcc
gccgcgcccgcgcaggccgccgcggctggtgccggtggtggcgagctcggcctgctgccg
tggccgaaggtcgatttcacccgcttcggcgaggtcgaaagcaaggccctgtcgcgcatc
aagaagatctcgggcgccaacctgcaccgcaactgggtcatgatcccgcacgtcaccaac
catgacgaagcggacatcaccgaactggaagccttccgcgtccagctgaacaaggaaaac
gaaaaggccggcatcaaggtgacgatgctcgccttcatgatcaaggccacggtggcggcg
ctgaagaagttcccgaacttcaatgcctcgctggacggtgacaacctcgtgctgaagaag
tacttcaacgtcggtttcgccgcggacaccccgaacggcctggtcgtgccggtgatcaag
gacgccgacaagaagggcgtgctggagatcagccaggaaatgaacgaactggccaagctg
gcacgcgacggcaagctcaagccggaccagatgcagggcggctgcttctcgatctcgtcg
ctgggcggcattggcggcacgtacttcacgccgatcatcaatgcgccggaagtggccatc
atgggcgtgtgcaagtcgtaccagaagcccgtgtgggacggcaagcagttcgtgccgcgc
ctgacgctgccactgtcgctgtcgtgggaccaccgcgtcatcgacggtgccgaggccgcg
cgcttcaacacgtacttcgggcaactgctggcggatttccgccggatcctgctgtaa

DBGET integrated database retrieval system