KEGG   Cupriavidus necator N-1: CNE_1c14020Help
Entry
CNE_1c14020       CDS       T01564                                 

Gene name
pdhB
Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cnc  Cupriavidus necator N-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNE_1c14020 (pdhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_1c14020 (pdhB)
   00020 Citrate cycle (TCA cycle)
    CNE_1c14020 (pdhB)
   00620 Pyruvate metabolism
    CNE_1c14020 (pdhB)
Enzymes [BR:cnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CNE_1c14020 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1412375..1414051
Genome map
AA seq 558 aa AA seqDB search
MSQAIEIKVPDIGDYDAVPVIEVHVKPGDSIDAEDALVTLESDKATMDVPSPQGGVVKEV
RIKVGDNVAEGSVLVMLEPAGQAAAAPAPAAAPAPAAAAPAPAAAAAPAAPAPAPAAAPA
GGGGIIEVKVPDIGDYDAVPVIEVHVKAGDTINAEDAVVTLESDKATMDVPSPQGGVVKE
VKVKVGDNVAEGTLLLILEGAAAAAAPAAAAAAPAPAPAASAPAPAPAPAAAAPAPAAAP
AAAPAAAGAIGKAAHASPSVRKFARELGVDVSRVPGTGPKGRITQEDVQGYVKGVMSGQA
AAPAQAAAAGAGGGELGLLPWPKVDFTRFGEVESKALSRIKKISGANLHRNWVMIPHVTN
HDEADITELEAFRVQLNKENEKAGIKVTMLAFMIKATVAALKKFPNFNASLDGDNLVLKK
YFNVGFAADTPNGLVVPVIKDADKKGVLEISQEMNELAKLARDGKLKPDQMQGGCFSISS
LGGIGGTYFTPIINAPEVAIMGVCKSYQKPVWDGKQFVPRLTLPLSLSWDHRVIDGAEAA
RFNTYFGQLLADFRRILL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgattgaaatcaaggtgccggatatcggcgactatgacgccgttcccgtc
attgaagtgcatgtgaaacccggcgacagcatcgacgcggaagacgcgctggtgacgctg
gagtcggacaaggccaccatggacgtgccctcgccgcagggcggcgtggtcaaggaagtc
aggatcaaggttggcgacaacgtcgccgaaggctcggtgctggtgatgctggagccggcc
ggccaggccgctgctgcgcccgcgcctgcagccgcaccggcgcctgccgccgctgcaccg
gccccggcagccgccgcagcccccgcagcccccgcgccggctccggccgcagcgccggct
ggcggtggcggcatcatcgaggtgaaggtgcctgatatcggcgactacgacgccgtgccg
gtcatcgaagttcacgtcaaggcgggcgacaccatcaatgccgaagacgccgtggtgacg
ctggagtccgacaaggccaccatggacgtgccgtcgccgcaaggcggcgtggtcaaggaa
gtcaaggtcaaggtcggtgacaacgtcgccgaaggcacgctgctgctgatcctggaaggc
gccgccgcagccgccgccccggccgctgccgccgcggcaccggctccggctccggctgcc
agcgcgcccgcaccggcgccggcccccgcagccgccgccccggctccggccgcagcgcct
gctgccgcgccggccgccgctggcgcaatcggcaaggccgcccacgccagcccctcggtg
cgcaagttcgcacgcgagctgggcgtggacgtgtcgcgcgtgccgggtaccggccccaag
ggccgtatcacccaggaagacgtgcagggctacgtcaagggcgtgatgagcggccaggcc
gccgcgcccgcgcaggccgccgcggctggtgccggtggtggcgagctcggcctgctgccg
tggccgaaggtcgatttcacccgcttcggcgaggtcgaaagcaaggccctgtcgcgcatc
aagaagatctcgggcgccaacctgcaccgcaactgggtcatgatcccgcacgtcaccaac
catgacgaagcggacatcaccgaactggaagccttccgcgtccagctgaacaaggaaaac
gaaaaggccggcatcaaggtgacgatgctcgccttcatgatcaaggccacggtggcggcg
ctgaagaagttcccgaacttcaatgcctcgctggacggtgacaacctcgtgctgaagaag
tacttcaacgtcggtttcgccgcggacaccccgaacggcctggtcgtgccggtgatcaag
gacgccgacaagaagggcgtgctggagatcagccaggaaatgaacgaactggccaagctg
gcacgcgacggcaagctcaagccggaccagatgcagggcggctgcttctcgatctcgtcg
ctgggcggcattggcggcacgtacttcacgccgatcatcaatgcgccggaagtggccatc
atgggcgtgtgcaagtcgtaccagaagcccgtgtgggacggcaagcagttcgtgccgcgc
ctgacgctgccactgtcgctgtcgtgggaccaccgcgtcatcgacggtgccgaggccgcg
cgcttcaacacgtacttcgggcaactgctggcggatttccgccggatcctgctgtaa

DBGET integrated database retrieval system