KEGG   Cupriavidus necator N-1: CNE_1c15250Help
Entry
CNE_1c15250       CDS       T01564                                 

Definition
LPT family ABC transporter ATP-binding protein (EC:3.6.3.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cnc  Cupriavidus necator N-1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CNE_1c15250
Enzymes [BR:cnc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CNE_1c15250
   3.1.2  Thioester hydrolases
    3.1.2.-  
     CNE_1c15250
Lipid biosynthesis proteins [BR:cnc01004]
 Fatty acid synthase
  Component type
   CNE_1c15250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1548933..1549589)
Genome map
AA seq 218 aa AA seqDB search
MDIGIRGKWRRLLLATGTALTLSAGASAQAAAPALLVLGDSLSAEYGITRGAGWVTLLQE
RLRQERFDYSVVNASISGETTIGGKTRLPELLSRHRPAIVVVELGANDALRGLPLQTTEA
NLRNIVTTAQTAGAGVLLIGMRIPPNYGQDYTEKFVSLYPKLASEYKVRLVPFFLDKVIT
RQDWFQPDRIHPTAAAQPALLDTVWPQLKPMLRRSGAK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggatattgggatccgaggcaaatggcgccggctgctgctggcaaccggcacggcactg
acgttatcggccggggcctcagcccaggccgcggcgccggcactgctggtgcttggcgac
agcctctccgccgagtacggcatcacgcgcggcgcgggctgggtcacgctgctgcaggag
cgcctgcggcaggagcgcttcgattatagcgttgtcaatgccagcatcagcggcgagacc
accatcggcggcaagacgcggctgccggagctgctgtcgcggcaccgcccggccatcgtg
gtggtggagcttggcgccaacgatgcgctgcgcggattgccgctgcagaccaccgaggcc
aacctgcgcaacatcgtcaccacggcacagacggccggcgcgggcgtgctgctgatcggc
atgcgcatcccgcccaactacgggcaggactacaccgagaagttcgtctcgctgtatccg
aagctggctagcgaatacaaggtgcggctggtgccgttcttcctcgacaaggtcatcacg
cggcaggactggttccagcccgaccgcatccacccgaccgccgcggcacagccagccctg
ctcgatacggtgtggccgcaactcaagccgatgctcaggcgcagcggcgcgaagtaa

DBGET integrated database retrieval system