KEGG   Cupriavidus necator: CNE_1c15250Help
Entry
CNE_1c15250       CDS       T01564                                 

Definition
LPT family ABC transporter ATP-binding protein (EC:3.6.3.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cnc  Cupriavidus necator
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cnc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1548933..1549589)
Genome map
AA seq 218 aa AA seqDB search
MDIGIRGKWRRLLLATGTALTLSAGASAQAAAPALLVLGDSLSAEYGITRGAGWVTLLQE
RLRQERFDYSVVNASISGETTIGGKTRLPELLSRHRPAIVVVELGANDALRGLPLQTTEA
NLRNIVTTAQTAGAGVLLIGMRIPPNYGQDYTEKFVSLYPKLASEYKVRLVPFFLDKVIT
RQDWFQPDRIHPTAAAQPALLDTVWPQLKPMLRRSGAK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggatattgggatccgaggcaaatggcgccggctgctgctggcaaccggcacggcactg
acgttatcggccggggcctcagcccaggccgcggcgccggcactgctggtgcttggcgac
agcctctccgccgagtacggcatcacgcgcggcgcgggctgggtcacgctgctgcaggag
cgcctgcggcaggagcgcttcgattatagcgttgtcaatgccagcatcagcggcgagacc
accatcggcggcaagacgcggctgccggagctgctgtcgcggcaccgcccggccatcgtg
gtggtggagcttggcgccaacgatgcgctgcgcggattgccgctgcagaccaccgaggcc
aacctgcgcaacatcgtcaccacggcacagacggccggcgcgggcgtgctgctgatcggc
atgcgcatcccgcccaactacgggcaggactacaccgagaagttcgtctcgctgtatccg
aagctggctagcgaatacaaggtgcggctggtgccgttcttcctcgacaaggtcatcacg
cggcaggactggttccagcccgaccgcatccacccgaccgccgcggcacagccagccctg
ctcgatacggtgtggccgcaactcaagccgatgctcaggcgcagcggcgcgaagtaa

DBGET integrated database retrieval system