KEGG   Cupriavidus necator N-1: CNE_1c15590Help
Entry
CNE_1c15590       CDS       T01564                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase PncA (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cnc  Cupriavidus necator N-1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CNE_1c15590 (pncA)
Enzymes [BR:cnc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CNE_1c15590 (pncA)
    3.5.1.-  
     CNE_1c15590 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1587540..1588184
Genome map
AA seq 214 aa AA seqDB search
MNTTIGPDDCLLVIDVQNDFMPGGALAVPHGDEVVPVINRLARAFGHVVLTQDWHPVSHV
SFAANHAGTQPFQTLTLPYGEQVLWPVHCVQDTPGAALHAGLHVPHARLVIRKGHHADVD
SYSAFLEADRATRTGLAGYLREHGVKRVFCAGLATDYCVAWSALDARAAGFAAAVIEDAC
RAIDLEGSLARAWQDLGAAGVARVTSAELLKGQG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccactatcggaccggacgattgcctgctggtgatcgacgtgcagaacgacttc
atgccgggcggcgcgcttgccgtgccccacggcgatgaggtggtgcccgtcatcaaccgg
ctggcgcgtgcgttcggtcatgtggtgctgacacaggactggcatcccgtcagccacgtc
tcgttcgcggccaaccatgcgggcacgcagccgttccagacgctgacgctgccgtatggc
gagcaggtgctgtggccggtgcattgcgtgcaggacacgcccggcgctgcgctgcatgcg
ggcctgcacgtgccgcatgcgcggctggtgatccgcaagggccatcacgccgatgtggac
agctactccgccttcctggaggcggaccgcgccacgcgcaccgggctagccggctacctg
cgcgagcatggcgtcaagcgcgtgttctgcgccgggctggcgacggactactgcgtggcc
tggagcgcgctcgatgcgcgcgccgcgggctttgccgccgcggtgatcgaggatgcctgc
cgcgccatcgacctggaagggtcgctggccagggcatggcaggacctcggcgccgccggc
gttgcgcgcgtcacgtccgctgaactgctcaagggccagggctga

DBGET integrated database retrieval system