KEGG   Cupriavidus necator N-1: CNE_1c16780Help
Entry
CNE_1c16780       CDS       T01564                                 

Gene name
betA2
Definition
choline dehydrogenase BetA (EC:1.1.99.1)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cnc  Cupriavidus necator N-1
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CNE_1c16780 (betA2)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     CNE_1c16780 (betA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1718354..1719958
Genome map
AA seq 534 aa AA seqDB search
MMSHALAYDVVVIGSGFGGAVSACRLAQAGRKVLVLERGRRWSPATYPRDESDPWLWNQE
RANRFNGWADIRTFSDVWVIAGAGVGGGSLIYANVSVEARPEAFEHGWPKEVTYAGLQAH
YEEVGRMLAVSEVPDNQLSERTRLLREGAEACGWGGRFRKLPLAVTFSEHWDPTRQDPRD
DRHSERFLNQHGRWQGTCVHCGNCDVGCQVSARNTLDLNYLAVAEDNGAEILPLHLVDRI
EPLQQGWRVCFRKIDPENETTSPGTVTAARVILAAGSIGSTELLLRCRDEHRTLPALSPR
LGFGWAHNGDFVTPAFYGNRTISPSHGVTISAAIDLLDHGGPNGQALFVEDGGIPNLAGN
FIRRHMKRTRSRKLRAVWKDVGGLFDDGDPVERMMPWFGQGVDPGDGQLKLGRRWYAPWR
RVLRLDWSYQASMAVIEAMIAAHTQLSGATGGDPWVPLTWRRWHNLITPHPLGGCNMGAS
AADGVVDAWGRVFGYKGLYVMDGAIVPRPLGLNPSRTIAALAERNVAMLLREQD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgagccatgccctggcctacgatgtcgtcgtcatcggcagcggcttcggtggtgcg
gtctcggcgtgccggctcgcgcaggccggccgcaaagtgctggtgctggagcgcggccgg
cgctggagcccagcgacttacccgcgcgacgaaagtgatccctggctgtggaaccaggag
cgcgccaatcgcttcaatggctgggccgatatccggacattctctgacgtatgggtcatc
gccggggccggagtcggtggcggctcgctgatctacgccaacgtttccgtggaagccagg
ccggaagcctttgagcacggctggccgaaagaggtgacctatgccggcctgcaggcccac
tacgaggaggtcgggcgcatgctcgcagtgagcgaagtgccggataaccagttgagcgag
cgaacccggctattgcgcgagggcgcggaagcctgcggatggggcgggcgcttccgtaaa
ttgccgctggcggtgacattttccgagcattgggaccccacacggcaagacccccgcgat
gaccgtcattcggagagattcctgaaccagcacggcaggtggcagggcacttgtgtccat
tgcggcaactgcgacgtggggtgccaggtatcggccaggaatacgctggacctgaattac
ctggcggtggctgaagacaatggcgccgagattctcccgttgcacctggtagacaggatc
gagccgctgcagcagggctggcgggtctgcttcaggaagatcgacccggaaaacgaaacg
acgagccctggcacagtcacggccgccagggtgatactggccgccggctccatcggcagc
accgagctactgctgcgctgtcgggatgagcatcgcacgctgcccgctctttcaccaagg
ttgggatttggctgggcccacaatggcgacttcgtgacgccagccttctatggcaacagg
acgatctctccttctcatggcgtgaccatctccgccgcgatcgacctgctggaccacggc
ggcccgaacggacaggcgctcttcgtcgaggacggcggcatcccgaacctcgcaggcaac
tttattcgacgtcatatgaagagaacgcgttcccgcaagctgcgcgcggtgtggaaggac
gtcggaggactgtttgacgacggcgatccggtcgagcggatgatgccgtggttcgggcaa
ggcgtggatcctggcgatggccagctgaagctgggccgcaggtggtacgcgccgtggcgt
cgggtgctgcggctcgactggtcgtatcaggcctcgatggcggtcatcgaggccatgatt
gcagcgcatacgcagctctcgggagcgaccggcggggatccgtgggtgccgctcacctgg
cggcggtggcacaacctgatcaccccgcacccgctgggaggctgcaacatgggggcctcc
gccgcggacggtgtcgtcgatgcatggggccgggtatttggctacaagggcctctatgtc
atggacggtgcgatcgtcccgcgcccgctcggcctgaacccttcgcgcaccatcgcggcg
ctcgcggagcgtaacgtggcgatgctcttgcgcgagcaggattga

DBGET integrated database retrieval system