KEGG   Cupriavidus necator N-1: CNE_1c17820Help
Entry
CNE_1c17820       CDS       T01564                                 

Definition
zinc-containing alcohol dehydrogenase superfamily
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CNE_1c17820
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_1c17820
  Lipid metabolism
   00071 Fatty acid degradation
    CNE_1c17820
  Amino acid metabolism
   00350 Tyrosine metabolism
    CNE_1c17820
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CNE_1c17820
   00626 Naphthalene degradation
    CNE_1c17820
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CNE_1c17820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1840704..1841825
Genome map
AA seq 373 aa AA seqDB search
MKDPHQTTIQAARVHEPGGRFRLDTIARPALLRPTDVLIDVKAAGVVPNLRNVMSNYGER
AYLTVPDLPAIYGLDTAGVVAEVGSQVTGVVPGDRVYINPGRSCGSCHACRTGEPINCTA
YTFQGYFGFGPESKRMYQQYPYGGFSEFATAPADGLVKLPDAITFEQAARFGYLGTAYSG
LRKAGVAAGRTVLISGATGTLGLGAVQIARAMGATRILCMARNVDLLERVRALDPQRIRI
LSYGTQPLADWVRAETDGIGADAFVDAIGPGASHQITLDGIAGLRRGGRMVEIGAMSDPL
PVNLHQLMCAQVSLVGSLWFSVAEGQELAAMAAAGTLDLTVFEHQRFGLHQVNEALATAE
KRAGGFVNVVVVQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccctcatcagaccaccatccaggccgcgcgtgtccatgaaccgggtggccgg
ttccgcctcgacacgattgcgcgcccagccttgctgcgccccaccgatgtgctgatcgac
gtgaaggcggcgggcgtggtgcccaacctgcgcaacgtgatgagcaactacggcgaacgc
gcctacctgaccgtaccggacctgcccgcgatctacggcctggataccgccggcgtcgtg
gcggaagtgggcagccaggtaaccggcgtggtccccggcgaccgcgtctatatcaacccg
gggcgctcgtgcggttcctgccatgcgtgccggaccggcgagccgatcaattgcacggct
tacaccttccagggctatttcggcttcgggccggagtcgaagcggatgtaccagcagtat
ccatatggcggcttcagtgaattcgccaccgcgcctgcggatggcttggtcaagctgccc
gacgcgatcaccttcgaacaggccgcgcgtttcggctacctgggtacggcgtactccggc
ctgcgcaaggccggcgttgcagcaggccgcacggtattgatcagcggcgctacaggcacg
ctcgggctcggcgccgtgcagatcgcgcgggccatgggcgctacccggatcctgtgcatg
gcgcgcaatgtcgacttgctggaacgcgtccgcgcgttggacccgcagcgtattcgcatc
ctttcctatggcacgcaacctctcgccgactgggttcgcgccgagacggacggcattggc
gccgatgcctttgtcgatgccatcggccccggcgcctcgcaccagatcacgctggacggt
atcgcgggcctccggcgtggcggccgcatggtggaaatcggggcgatgtcggacccgttg
cccgtcaacctgcaccaactgatgtgcgcgcaggtcagcctggtcggatcactctggttc
tcggtggccgaaggccaggaacttgccgccatggctgcggcaggcacgctcgacctcacg
gtcttcgagcaccagcggttcggcctgcaccaggtcaatgaagccctcgccaccgccgag
aagcgcgctggcggatttgtcaacgtggttgtcgtgcaatga

DBGET integrated database retrieval system