KEGG   Cupriavidus necator: CNE_1c19340Help
Entry
CNE_1c19340       CDS       T01564                                 

Gene name
catA2
Definition
catechol 1,2-dioxygenase CatA (EC:1.13.11.1)
Orthology
K03381  
catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
cnc  Cupriavidus necator
Pathway
Chlorocyclohexane and chlorobenzene degradation
Benzoate degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol ortho-cleavage, catechol => 3-oxoadipate
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cnc01220]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:cnc00362]
Metabolism; Xenobiotics biodegradation and metabolism; Fluorobenzoate degradation [PATH:cnc00364]
Metabolism; Xenobiotics biodegradation and metabolism; Chlorocyclohexane and chlorobenzene degradation [PATH:cnc00361]
Metabolism; Xenobiotics biodegradation and metabolism; Toluene degradation [PATH:cnc00623]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1999543..2000478)
Genome map
AA seq 311 aa AA seqDB search
METPMTHSEIDALVHSFIVATGTQGTPDPRVQQVVVRLTADLFKAIEDLDLSASEVWKGI
EYFAEAGATQELGLLAAGLGLERFLDVRADEAEARAGLTGGTPRTIEGPLYVAGAPESTG
FARLDDGSDDGKGEVLFMQGTVYGADGKPLPGARVEVWHANLMGNYSFFDKTQSHFNLRR
TIVTDANGRYQFRSNVPNGYGCPPEGTTQRLLDQLARHGRRPAHIHFFVSADGHRKLTTQ
INIDGDEYLWDDFAFASREGLVPAVTRVTDAAALDKHGVDKPFASIDFDFRLLPEQAGAP
AAEVERQRAAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagacccccatgactcactcggaaatcgacgccctggtccacagctttatcgtcgcc
accggcacgcaaggcacccccgacccgcgcgtgcagcaggtggtagtccgcctgaccgcg
gacctgttcaaggcgatcgaggacctcgacctgagcgccagcgaggtctggaagggcatt
gagtacttcgccgaggcgggcgccacccaggagttgggcctgctcgccgctggcctgggg
ctggaacgcttcctcgacgtccgcgccgacgaggctgaagcccgcgccggcctgaccggc
ggcacgccgcgcaccatcgaaggcccgctctacgtggccggcgccccggaaagcaccggc
tttgcccggctcgacgacggcagcgacgacggcaagggcgaggtcctgttcatgcaaggc
acggtgtacggcgccgacggcaagccgctgcccggtgccagggtcgaggtgtggcatgcc
aacctgatgggcaactactcgttcttcgacaagacccagtcgcacttcaacctgcgccgc
accatcgtcaccgacgccaacggccgctaccagttccgcagcaacgtgccaaacggctac
ggctgcccgccggaaggcaccacccagcgcctgctggaccagctcgcgcgccacggccgg
cgcccggcccacatccacttcttcgtgtcggcggacggccaccgcaagctgaccacgcag
atcaacatcgacggcgacgaatacctgtgggacgacttcgccttcgccagccgcgagggg
ctggtgccggcggtgacccgcgtcaccgacgccgccgcgctcgacaaacacggcgtggac
aagccgtttgcctcgatcgacttcgatttccggctgctgccggagcaggccggcgccccc
gccgccgaggtggagcgccagcgcgccgctgcctga

DBGET integrated database retrieval system