KEGG   Cupriavidus necator: CNE_1c19560Help
Entry
CNE_1c19560       CDS       T01564                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
cnc  Cupriavidus necator
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:cnc00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2021901..2022917
Genome map
AA seq 338 aa AA seqDB search
MKISDRLAAFSRLDLVGAATPLQKLDRLSGMVGRDIYVKRDDTTPLAFGGNKLRKLEFLA
ADALRQGADTLVTAGAIQSNHVRQTAALAARLGLRCSALLENPTGTADGDYLHSGNRLLL
DLFDAQAEPVTSLDNADAQLQALAERLRGEGHKPYVIPIGGSNPLGALGYVRAGLELAQQ
AEAMGLAFSAVVLASGSAGTHGGLALALAHAMPDTPVVGVTVSRSVAAQVPKVARLIEGT
AALLDVEVPAGLKVELWDEYFAPRYGEPNQAGLEAIRILAGTEGVLLDPVYTGKAMAGLL
DGVARGRFASAGPVLFLHTGGAPALFAYRNAINTGPRD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctcggatcgccttgccgctttctcccgcctcgatctggtcggcgcggccacg
cccctgcaaaagcttgaccgcctgtccgggatggtcgggcgcgatatctacgtcaagcgg
gatgacaccacaccacttgcgtttggcggaaacaaactgcgcaagcttgagttcctggcg
gctgacgccttgcgccagggcgccgatacgctggtaacggccggagccatacagtcgaat
catgtccggcagacggccgcgctggcggcccgtcttgggctacgctgcagcgcgttgctg
gaaaacccgaccggcacggcagacggcgactacctgcacagcggcaaccgcctgctgctc
gatttgttcgacgcacaggccgagccggttaccagtctcgacaacgccgacgcacagttg
caggcccttgcggaacggctgcgtggcgaggggcacaagccgtatgtcatcccgatcggc
gggtccaatccgctgggggcattggggtatgtacgtgccgggctggagctggcgcagcaa
gccgaggcgatgggtcttgcgttctcggcggtcgtgctggcgtccggcagtgccggaacc
catggcgggcttgcgttggcgctcgcacacgcgatgccggatacaccggtcgtcggtgtt
accgtgtcccgcagcgtcgcggcgcaagttccgaaggtggctaggctgattgaagggact
gccgcactgctcgatgtcgaggtgccggcagggctgaaggtcgagctgtgggacgagtac
ttcgcacctcgctatggtgagcccaaccaggcggggctggaggccatccgcatcctggca
ggtaccgaaggtgtgttgctcgatcccgtctatacggggaaggcgatggctggcttgctc
gatggcgtcgcgcgcgggcgttttgcttcggctggcccggtgttgttcctgcataccggt
ggtgcgccggcgttgtttgcgtatcgcaatgcaatcaacacaggcccgagggactga

DBGET integrated database retrieval system