KEGG   Cupriavidus necator N-1: CNE_1c19560Help
Entry
CNE_1c19560       CDS       T01564                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
cnc  Cupriavidus necator N-1
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CNE_1c19560 (dcyD)
Enzymes [BR:cnc01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     CNE_1c19560 (dcyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2021901..2022917
Genome map
AA seq 338 aa AA seqDB search
MKISDRLAAFSRLDLVGAATPLQKLDRLSGMVGRDIYVKRDDTTPLAFGGNKLRKLEFLA
ADALRQGADTLVTAGAIQSNHVRQTAALAARLGLRCSALLENPTGTADGDYLHSGNRLLL
DLFDAQAEPVTSLDNADAQLQALAERLRGEGHKPYVIPIGGSNPLGALGYVRAGLELAQQ
AEAMGLAFSAVVLASGSAGTHGGLALALAHAMPDTPVVGVTVSRSVAAQVPKVARLIEGT
AALLDVEVPAGLKVELWDEYFAPRYGEPNQAGLEAIRILAGTEGVLLDPVYTGKAMAGLL
DGVARGRFASAGPVLFLHTGGAPALFAYRNAINTGPRD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctcggatcgccttgccgctttctcccgcctcgatctggtcggcgcggccacg
cccctgcaaaagcttgaccgcctgtccgggatggtcgggcgcgatatctacgtcaagcgg
gatgacaccacaccacttgcgtttggcggaaacaaactgcgcaagcttgagttcctggcg
gctgacgccttgcgccagggcgccgatacgctggtaacggccggagccatacagtcgaat
catgtccggcagacggccgcgctggcggcccgtcttgggctacgctgcagcgcgttgctg
gaaaacccgaccggcacggcagacggcgactacctgcacagcggcaaccgcctgctgctc
gatttgttcgacgcacaggccgagccggttaccagtctcgacaacgccgacgcacagttg
caggcccttgcggaacggctgcgtggcgaggggcacaagccgtatgtcatcccgatcggc
gggtccaatccgctgggggcattggggtatgtacgtgccgggctggagctggcgcagcaa
gccgaggcgatgggtcttgcgttctcggcggtcgtgctggcgtccggcagtgccggaacc
catggcgggcttgcgttggcgctcgcacacgcgatgccggatacaccggtcgtcggtgtt
accgtgtcccgcagcgtcgcggcgcaagttccgaaggtggctaggctgattgaagggact
gccgcactgctcgatgtcgaggtgccggcagggctgaaggtcgagctgtgggacgagtac
ttcgcacctcgctatggtgagcccaaccaggcggggctggaggccatccgcatcctggca
ggtaccgaaggtgtgttgctcgatcccgtctatacggggaaggcgatggctggcttgctc
gatggcgtcgcgcgcgggcgttttgcttcggctggcccggtgttgttcctgcataccggt
ggtgcgccggcgttgtttgcgtatcgcaatgcaatcaacacaggcccgagggactga

DBGET integrated database retrieval system