KEGG   Cupriavidus necator N-1: CNE_1c21150Help
Entry
CNE_1c21150       CDS       T01564                                 

Gene name
iclA
Definition
isocitrate lyase IclA (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNE_1c21150 (iclA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CNE_1c21150 (iclA)
Enzymes [BR:cnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CNE_1c21150 (iclA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2187846..2189426)
Genome map
AA seq 526 aa AA seqDB search
MAQYQDDIKAVAGLKENHGSAWNAINPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADSSKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAQGPAKAAIQAKIDNHVTHVVPIIAD
IDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAIR
YAFLELGVDDGIIVARTDSLGAGLTKQIAVTNTPGDLGDQYNSFLDCEELSADALGNGDV
IIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCVTALQNGADLLWIETEKPHIAQIGGM
VSEIRKVIPNAKLVYNNSPSFNWTLNFRQQAYDALKAAGKDVSAYDRAQLMSVEYDQTEL
AKLADEKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQR
KEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtatcaagacgacatcaaggcagttgctggtttgaaagagaaccacggcagc
gcgtggaatgccatcaatcccgagtatgccgcccgcatgcgtgcccagaacaagttcaaa
acgggcctggacatcgccaaatacaccgccaagatcatgcgcgccgacatggccgcctac
gatgccgactcgtcgaagtacacccagtcgctgggctgctggcacggcttcatcggccag
cagaagatgatctccatcaagaagcacttcaacagcaccgagcgccgctacctttacctg
tccggctggatggtggctgcgctgcgctccgagttcggcccgctgccggaccagtcgatg
cacgaaaaaacctccgtcagcgcgctgatccgcgagctgtacaccttcctgcgccaggct
gacgcccgtgaactgggcggcctgttccgcgagctggacgctgcccaaggccctgccaag
gccgccatccaggcgaagatcgacaaccacgtcacccacgtcgtgcccatcatcgcggac
atcgacgcgggttttggcaacgccgaagcaacgtacctgctggccaagcagttcatcgaa
gcgggcgcatgctgcattcagatcgaaaaccaggtgtccgacgagaagcagtgcggccac
caggatggcaaggtcaccgtgccgcatgaggacttcctggccaagatccgcgccatccgc
tacgccttcctggaactgggcgtggacgacggcatcatcgtggcccgtaccgactcgctg
ggtgccggcctgaccaagcagatcgccgtgaccaacacgccgggcgacctgggcgaccaa
tacaattccttcctcgattgcgaagaattgtcggccgacgcactgggtaatggtgacgtc
atcatcaagcgcgacggcaagctgctgcgtcccaagcgcctgcctagcaacctgttccag
ttccgcgccggcacgggcgaagcgcgctgcgtactggattgcgtcaccgcactgcaaaac
ggcgctgacctgctctggatcgaaaccgaaaaaccgcatatcgcccagatcggcggcatg
gtcagcgagattcgcaaggtcatcccgaacgccaagctggtgtacaacaacagcccgtca
ttcaactggaccctgaacttccgccagcaggcgtatgacgcgctgaaagccgcgggcaag
gatgtgtcggcatatgaccgcgcccagctgatgagcgttgaatacgaccagaccgaactg
gcgaagctcgccgacgaaaagatccggaccttccaggccgacgcgtcgcgcgaagcagga
atcttccaccacctgattacgctgccgacctaccacaccgccgcactgtcgaccgacaac
ctggccaaggaatacttcggcgaccagggcatgctgggttatgtggctggcgtgcagcgc
aaggaaatccgccagggcatcgcctgcgtgaagcaccagaacatgtccggctcggacatc
ggcgacgaccacaaggagtatttcagcggcgaagcggccctgaaagcggcgggtaaagac
aacaccatgaaccagttctga

DBGET integrated database retrieval system