KEGG   Cupriavidus necator: CNE_1c21320Help
Entry
CNE_1c21320       CDS       T01564                                 

Gene name
aceA
Definition
isocitrate lyase AceA (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cnc  Cupriavidus necator
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cnc01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cnc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2203659..2204954)
Genome map
AA seq 431 aa AA seqDB search
MTRQEQIQALQKDWDTNPRWKGIKRNFTAEDVVRLRGSVQVEHTLARRGSEKLWNLLHTE
PFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVKR
INNTFQRADQIQWSEGKGDTDFFAPIVADAEAGFGGVLNAFELMKSMIEAGAAGVHFEDQ
LASVKKCGHMGGKVLVPTREAVAKLTAARLAADVSGVPTLVIARTDAEAADLLTSDVDEN
DRPFCTGERTVEGFYRVRNGLEQSISRALAYAEVADLVWCETGKPDLEFAKKFAEAVHAK
FPGKMLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHSLNYSMFNLAYG
YARNQMSAFVELQEAEFKAAEKGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTALKGSTE
NEQFFEDKKVA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccaagaacagatccaggccctgcagaaagactgggataccaatccccgctgg
aagggtatcaagcgcaacttcaccgccgaagacgtggtgcgcctgcgtggttcggttcag
gtcgaacacactctggcacgccgcggctccgagaagctgtggaacctgttgcacaccgag
ccgttcgtcaactcgctgggcgcgctgaccggcaaccaggccatgcagcaagtgaaggcc
ggcctgaaggccatctacctgtcggggtggcaagtcgcaggcgacgccaacctggccggt
gaaatgtaccccgaccagtcgctgtacccggccaactcggtgccgcaagtcgtcaagcgc
atcaacaacaccttccagcgcgccgaccagatccagtggagcgaaggcaagggcgacacc
gacttcttcgccccgatcgtggcggatgctgaagccggcttcggcggcgtgctgaatgcg
ttcgaactgatgaagtcgatgatcgaagcgggcgccgccggcgtgcacttcgaagaccaa
ctcgcttcggtgaagaagtgcggccacatgggcggcaaggtgctggtgccgacccgcgaa
gccgtcgccaagctgaccgctgcccgcctggccgccgacgtctcgggcgtgccgaccctg
gtgatcgcccgtaccgacgccgaggccgccgacctgctgacctcggacgtagacgagaac
gacaggccgttctgcaccggcgagcgcaccgtggaaggtttctaccgcgtgcgcaacggc
ctggagcagtcgatctcgcgcgccctggcctacgctgaagtggctgacctggtgtggtgc
gaaaccggcaagccggacctcgagttcgccaagaagtttgccgaagccgtgcacgccaag
ttcccaggcaagatgctggcctacaactgctcgccgtcgttcaactggaagaagaacctg
gacgacgccaccatcgccaagttccagagggaactgggcgctatgggctacaagttccag
ttcatcaccctggccggcttccactcgctgaactactcgatgttcaacctggcctacggc
tacgcccgcaaccagatgagcgcgttcgtggaactgcaggaagccgagtttaaggcagcc
gagaagggcttcaccgcggtcaagcaccagcgcgaagtcggcaccggctacttcgacgcc
gtgacccagaccatcgaaggcggccagtcgtcgacgaccgccctgaaaggttcgaccgaa
aacgaacagttcttcgaagacaagaaagtggcctga

DBGET integrated database retrieval system