KEGG   Cupriavidus necator N-1: CNE_1c22340Help
Entry
CNE_1c22340       CDS       T01564                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00020  Citrate cycle (TCA cycle)
cnc00310  Lysine degradation
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
cnc01200  Carbon metabolism
Module
cnc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cnc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNE_1c22340 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CNE_1c22340 (sucB)
Enzymes [BR:cnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CNE_1c22340 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AEI77568
UniProt: G0EZY3
Position
1:complement(2305775..2307034)
Genome map
AA seq 419 aa AA seqDB search
MAIVDVKVPQLSESVAEATMLNWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLSII
VKNDGDTVVADEIIAKIDTEATAGAAAPAAAAPAPAAAAPAPAAAAAAPAAAGGVAMPSA
AKLMAEAGLSAGQVAGTGKDGRITKGDALAAAAAPAAPAAKAAPAPAAAKPALQQVSAPV
DFAALGDRPEERVPMSRLRARIAERLLQSQSTNAILTTFNEVNMKPVMDLRNKYKDRFEK
EHGVKLGFMSFFVKAAVHALKKFPLINASIDGNDIVYHGYFDIGIAVGSPRGLVVPILRN
ADQMSLADIEKKIAEFGVKARDGKLSLEELTGGTFSISNGGVFGSMLSTPIINPPQSAIL
GVHATKDRPVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPARLLLDL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgacgtcaaggttccgcagctctccgaatcggtcgccgaagcgaccatg
ctcaactggaagaagaagccgggcgaggctgttgcacaggacgaaatcctgatcgagatc
gaaaccgacaaggtcgtgctggaagtgccggccccgtcggcaggcgtcctgtcgattatc
gtcaagaacgacggcgacaccgtcgtggccgatgagatcatcgcgaagatcgacaccgaa
gccaccgctggcgccgccgcaccggctgctgccgctccggcacctgccgccgctgccccg
gcaccggccgctgctgccgccgctccggccgccgcaggtggtgtggcgatgccgtcggct
gccaagctgatggcagaagccggcctgtcggctggccaggttgccggcaccggcaaggac
ggccgcatcaccaagggtgacgcgctggccgctgctgctgctccggccgccccggccgcc
aaggctgctccggctccggccgccgccaagccggcgctgcagcaggtttcggccccggtt
gacttcgccgcgctgggcgaccgcccggaagagcgtgtgccgatgagccgcctgcgcgcc
cgtatcgccgagcgcctgctgcaatcgcaatcgaccaacgccatcctcaccaccttcaat
gaagtgaacatgaagccggtgatggacctgcgcaacaagtacaaggaccgcttcgagaag
gaacacggcgtcaagctgggcttcatgtcgttcttcgtcaaggccgcggtgcacgcgctg
aagaagttcccgctgatcaacgcttcgatcgacggcaacgacatcgtctaccacggctac
ttcgacatcggcatcgcggtgggctcgccgcgcggcctggtggtgcccatcctgcgcaat
gccgaccagatgagcctggccgacatcgagaagaagattgccgagttcggcgtcaaggcc
cgtgacggcaagctgtcgctggaagaactgaccggcggtacgttctcgatctccaacggc
ggcgtgttcggctcgatgctgtcgaccccgatcatcaacccgccgcaatcggccatcctg
ggcgtgcacgccaccaaggaccgcccggtggtggaagacggccagatcgtgatccgcccg
atgaactatctggcgatgtcgtatgaccaccgcatcatcgacggccgtgaagctgtcctg
ggcctggtcgccatgaaggacgcgctggaagatccggcccgtctgctgctggacctgtaa

DBGET integrated database retrieval system