KEGG   Cupriavidus necator: CNE_1c23550Help
Entry
CNE_1c23550       CDS       T01564                                 

Gene name
folP
Definition
dihydropteroate synthase FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cnc  Cupriavidus necator
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cnc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2440465..2441394)
Genome map
AA seq 309 aa AA seqDB search
MHRLFLLRDGFAHRLSSSIPTLQQTPQTRYFQCGRFRYALDQRPLVMGILNVTPDSFSDG
GQHASRDAALRHAEQMIQEGVDVIDIGGESSRPGSAALPLEDELARVIPVVEALRNCGKP
LSIDTYKPEVMRAALAAGADLINDIWGFRMPGAVEAVAAGQAGLCVMHMQRDPQTMQEDP
HYDDVVAEVAGFLAERIAVLRAAGIDDARISLDPGFGFGKTPDHNLRLLGQLPRLALEGL
PVLAGISRKSTLGAVLGGRPPQQRVAASIAAAVCALERGAFIVRVHDVEQTVDAVKTWWA
VRNESVGAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccggcttttccttttgcgcgacgggttcgcgcacagactttcctcaagtattccg
accttgcagcagactcctcagacccggtacttccagtgcggacgtttccgctatgcgttg
gaccagcgcccgctggtcatgggcattctcaatgtcacgccagattcgttctccgacggc
ggccagcacgccagccgcgatgcggcgctgcgccacgcggagcagatgatccaggagggg
gtggacgtcatcgatatcggtggcgagtcgagccgcccgggctcggccgcgctgccgctt
gaggacgaactggcccgcgtgatccccgtggtggaagcgctgcgcaactgcggcaagccg
ctgtcgatcgatacctacaagcccgaggtcatgcgcgccgcacttgcggccggagccgat
ctcatcaacgatatctggggtttccgcatgccgggcgcggtcgaggccgtggcggcgggg
caggcgggcctgtgcgtgatgcatatgcagcgcgatccgcagaccatgcaggaagacccg
cactacgacgacgtggtcgccgaggtggccgggttccttgccgagcgcattgccgtgctg
cgcgctgccggcatcgacgatgcgcgcatatccctcgatccggggtttggcttcggaaag
acacccgatcataatctgcgcctgctcggccaattgccgcggctggcgctggagggcctg
ccggtgctggcgggcatttcgcgcaagtccacgctgggcgccgtcctcggtggccggccg
ccgcagcagcgtgttgcggccagcattgccgccgcggtgtgtgcgctggagcgcggagca
tttatcgtgcgcgtgcatgatgtggagcagacggtggatgccgtgaagacctggtgggcg
gtgcgcaacgagtccgttggcgcggcctga

DBGET integrated database retrieval system