KEGG   Cupriavidus necator N-1: CNE_1c23550Help
Entry
CNE_1c23550       CDS       T01564                                 

Gene name
folP
Definition
dihydropteroate synthase FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cnc  Cupriavidus necator N-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CNE_1c23550 (folP)
Enzymes [BR:cnc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CNE_1c23550 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2440465..2441394)
Genome map
AA seq 309 aa AA seqDB search
MHRLFLLRDGFAHRLSSSIPTLQQTPQTRYFQCGRFRYALDQRPLVMGILNVTPDSFSDG
GQHASRDAALRHAEQMIQEGVDVIDIGGESSRPGSAALPLEDELARVIPVVEALRNCGKP
LSIDTYKPEVMRAALAAGADLINDIWGFRMPGAVEAVAAGQAGLCVMHMQRDPQTMQEDP
HYDDVVAEVAGFLAERIAVLRAAGIDDARISLDPGFGFGKTPDHNLRLLGQLPRLALEGL
PVLAGISRKSTLGAVLGGRPPQQRVAASIAAAVCALERGAFIVRVHDVEQTVDAVKTWWA
VRNESVGAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccggcttttccttttgcgcgacgggttcgcgcacagactttcctcaagtattccg
accttgcagcagactcctcagacccggtacttccagtgcggacgtttccgctatgcgttg
gaccagcgcccgctggtcatgggcattctcaatgtcacgccagattcgttctccgacggc
ggccagcacgccagccgcgatgcggcgctgcgccacgcggagcagatgatccaggagggg
gtggacgtcatcgatatcggtggcgagtcgagccgcccgggctcggccgcgctgccgctt
gaggacgaactggcccgcgtgatccccgtggtggaagcgctgcgcaactgcggcaagccg
ctgtcgatcgatacctacaagcccgaggtcatgcgcgccgcacttgcggccggagccgat
ctcatcaacgatatctggggtttccgcatgccgggcgcggtcgaggccgtggcggcgggg
caggcgggcctgtgcgtgatgcatatgcagcgcgatccgcagaccatgcaggaagacccg
cactacgacgacgtggtcgccgaggtggccgggttccttgccgagcgcattgccgtgctg
cgcgctgccggcatcgacgatgcgcgcatatccctcgatccggggtttggcttcggaaag
acacccgatcataatctgcgcctgctcggccaattgccgcggctggcgctggagggcctg
ccggtgctggcgggcatttcgcgcaagtccacgctgggcgccgtcctcggtggccggccg
ccgcagcagcgtgttgcggccagcattgccgccgcggtgtgtgcgctggagcgcggagca
tttatcgtgcgcgtgcatgatgtggagcagacggtggatgccgtgaagacctggtgggcg
gtgcgcaacgagtccgttggcgcggcctga

DBGET integrated database retrieval system