KEGG   Cupriavidus necator: CNE_1c23920Help
Entry
CNE_1c23920       CDS       T01564                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cnc  Cupriavidus necator
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cnc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2481251..2482822
Genome map
AA seq 523 aa AA seqDB search
MNQPAAQAQRPASSQLPTEPQYVLALDQGTSSSRAILFDHAGNVVRLAQREFRQYYPHPG
HVEHDPYEIWQSQLAVAHAVLADAGISASQVRAIGITNQRETTVLWDRKTGEPVGRALVW
QDRRTAPMCEALQAAGHGELFRDKTGLIIDAYFSGTKLRWMLDNIEGARERAQRGELAFG
TVDSWLIWQLTDGARHVTDVSNASRTMLFNIHSFEWDDALLALLDIPHALLPEVVASSGE
VARTSARLFGMQIPIAGIAGDQQAATFGQACLSPGMAKNTYGTGCFLLMNTGSQPVTSHN
RLLTTIGWQIRGQTQYCLEGGVFMGGATIQWLRDGLKIINSAPEVEPLARQCDDTGGVVL
VPAFAGLGAPHWDPFARGTLVGMTRGTGRPQIARAALESIALQSVDVLEAMQKDAGISLA
ELRVDGGASRSDLLMQMQADLLGTPVVRPRVTETTALGAAYLAGLATGYWSDPAEIAQQW
QVERRFEPNLSADARGHRLARWHRAVDRARDWAREDQANGSHA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccagccgcgcaggcccagcgccctgcatcgtcccagcttcccaccgagccg
caatatgtgctggcgctcgaccagggcaccagcagctcgcgggccatcctgttcgaccat
gccggcaatgtggtgcgactcgcgcagcgcgagttccgccaatattacccacatcccggc
catgtcgagcacgacccttacgagatctggcaatcgcagctggcggtggcgcacgcggtg
ctggccgatgccggcatctctgcctcgcaggtgcgcgccatcggcatcaccaaccagcgc
gagaccactgtgctgtgggaccgcaagaccggcgagccggtcgggcgcgcgctggtctgg
caggaccgccgcaccgcgcccatgtgcgaggcactgcaggccgccggccacggcgaactg
ttccgcgacaagaccggcctgatcatcgatgcctacttctccggcaccaagctgcgctgg
atgctcgacaacatcgaaggcgcgcgcgaacgcgcccagcgcggcgaactggccttcggc
accgtcgacagctggctgatctggcagctgaccgacggcgcgcgccatgtcactgatgtg
tcaaatgcctcgcgcacgatgctgttcaatatccacagcttcgagtgggacgacgcgctg
ctggcgctgctcgacatcccgcacgcgctgctgcctgaggtggtggcgtccagcggcgag
gtggcgcgcacctcggcgcggctcttcggcatgcagatccccattgccggcatcgccggc
gaccagcaggccgccaccttcggccaggcctgcctgtcgccgggcatggccaagaacacc
tacggcaccggctgcttcctgctgatgaataccggctcgcagccggtcacgtcgcacaac
cggctgctgaccacgatcggctggcagatccgcggccagacgcaatattgcctggaaggc
ggcgtgttcatgggcggcgccaccatccagtggctgcgcgacggcctgaagatcatcaac
agcgcgcccgaggtcgagccgctcgcgcgccagtgcgacgacaccggcggcgtggtgctg
gtgcccgcctttgccggcctgggcgcgccgcactgggacccctttgcacgcggcacgctg
gtcggcatgacgcgcggcacgggccggccgcagatcgcgcgcgccgcgctggaatcgatc
gcgctgcagagcgtcgatgtgctggaagccatgcagaaggacgccggcatctcgctggcc
gagctgcgcgtggacggcggcgcctcgcgcagcgacctgctgatgcagatgcaggccgac
ctgctcggcaccccggtggtccgcccgcgcgtgaccgaaaccaccgcgctgggcgccgcc
tacctggcgggcctggccaccggctactggagcgatccggcagagatcgcgcagcaatgg
caggtggagcggcgctttgagccgaacctgtcggctgacgcgcgcggccaccggctggcg
cgctggcatcgcgccgtcgaccgcgcgcgcgactgggcgcgcgaggaccaagccaacggc
agccacgcctga

DBGET integrated database retrieval system