KEGG   Cupriavidus necator: CNE_1c24340Help
Entry
CNE_1c24340       CDS       T01564                                 

Gene name
nagZ
Definition
beta-hexosaminidase NagZ (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cnc  Cupriavidus necator
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cnc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cnc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2518243..2519292)
Genome map
AA seq 349 aa AA seqDB search
MSKKNSGKRPGPVVLDVVGKQLDAEDARRIAHPLTGGVILFARNFESRAQLLALTRAIRA
VRDDVLICIDHEGGRVQRCKTDGFTHLPAMHRLGGLWERDVLAATKAAVACGYVLAAELR
ACDIDLSFTPVLDLDYGRSAVIGDRAFHADPRVVSMLAGHLNHGLLLAGMSNCGKHFPGH
GYVEADSHVAIPVDERSLDEILEQDARPYEWLGLSLSSVMPAHVIYPKVDPNPAGFSRYW
LQDVLRAQLGFEGVIFSDDLSMEGASVAGNVTEAARAALTAGCDMVLICNHPERADQLLS
ELDVGIDKTSQRRIRKLFARRKPLDWNKLHQEGEYRAALRMLKEHDLIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaagaactccggcaagcggccgggcccggtggtcctcgacgtcgtcggcaag
cagctcgacgcggaggatgcgcgccgcatcgcgcatccgctgaccggcggcgtgatcctg
ttcgcgcgcaatttcgagtcgcgcgcgcaactgctggcgctgacgcgcgcgatccgagca
gtgcgcgacgacgtgctgatctgcatcgaccatgaaggcgggcgcgtgcagcgctgcaag
accgacggcttcacccacctgccggcgatgcaccgcctgggcgggctgtgggagcgcgac
gtgctggccgcgaccaaggccgccgtggcctgcggctacgtgctggccgccgagctgcgc
gcctgtgacatcgacctgagcttcaccccggtgctggacctggactacggccgcagcgcc
gtgatcggcgaccgcgccttccacgccgatccgcgcgtggtgtcgatgctggccggccac
ctgaaccacggcctgctgctggccgggatgagcaactgcggcaagcacttccccggccac
ggctatgtcgaggccgattcgcacgtggcgatcccggtcgacgagcgctcgctggacgag
atcctggagcaggatgcgcgcccgtatgaatggctgggcctgtcgctgtcttcggtgatg
ccggcgcacgtgatctaccccaaggtcgacccgaacccggccggcttctcgcgctactgg
ctgcaggatgtgctgcgcgcccagctgggcttcgagggcgtgatcttcagcgacgacctc
agcatggaaggcgccagcgtcgccggcaatgtcaccgaggccgcgcgcgccgcgctgacc
gcgggctgcgacatggtgctgatctgcaaccatccggagcgcgccgaccagttgcttagc
gagctggacgtgggcatcgacaagacctcgcagcgccgcatccgcaagctgttcgcgcgc
aggaagccactggactggaacaagctgcaccaggaaggcgagtaccgcgccgcgctgcgc
atgctgaaagagcacgacctgatcgcctga

DBGET integrated database retrieval system