KEGG   Cupriavidus necator: CNE_1c24620Help
Entry
CNE_1c24620       CDS       T01564                                 

Gene name
rluC
Definition
ribosomal large subunit pseudouridine synthase C (EC:5.4.99.-)
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
cnc  Cupriavidus necator
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2542330..2543334)
Genome map
AA seq 334 aa AA seqDB search
MNELRHQIEKAAEAAPASPQVAYVTIDEGSEGQRIDNFLLKVAKGVPKSHIYRVLRSGEV
RVNKGRIDATYRLQSGDVVRIPPMRVANSAQSDNAQHVPAGEFPVLFEDAQLLVINKPAG
VAVHGGSGVAFGVIEQLRRSRPQAKFLELVHRLDRETSGILVLAKKRSALVHLHEQIRGS
AMDKRYFACVAGEFPNARQHVKLPLYKYSTPDGERRVRVQADGLASHTVFNRVEAFQGFT
LLEAELKTGRTHQIRVHLAHSGFPIVGDEKYGDFSLNKALARSGAKPGLKRMFLHAHRLV
FIHPATGEPLAVEAPLPDECVGFLQQLRELHAPE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagttacgccatcaaattgaaaaggctgccgaagctgcgccggccagcccacag
gtggcgtatgtcacgattgacgaaggctcggaaggtcagcgcattgacaatttcctgctg
aaggtggccaagggcgtgcccaagagccatatctaccgggtgctgcgttcgggtgaagtt
cgcgtcaataagggccggatcgatgccacttatcgcctgcagtcgggtgatgtcgtgcgc
attccgccaatgcgggtggcgaattcggcgcaatcggacaatgcccagcatgtgccagcg
ggcgaattcccggtgctgtttgaggacgcccagctgctggtgatcaacaagccggccggc
gtggccgtgcacggcggctcgggcgtggccttcggtgtgatcgagcaattgcgccggtcc
cggccccaggccaagttcctggaactggtgcaccggctcgatcgcgagacctccggcatc
ctggtgctggccaagaagcgctcggcgttggtccacctgcacgagcagattcgcggcagc
gcgatggacaagcgctatttcgcctgcgtggccggcgaattcccgaacgcgcgccagcat
gtgaagctgcctctatataagtacagcacgccggacggcgagcgccgggtgcgggtgcag
gccgacgggctggcctcgcacaccgtgttcaaccgggtcgaggccttccagggcttcacc
ctgctggaggccgagctgaagactggccgtacccaccagatccgcgttcacctggcccac
tcgggcttcccgattgtcggggacgaaaaatatggcgacttctcgctgaacaaggcgctg
gcgcgttccggtgccaagccgggcctcaaacgcatgttcctgcacgcccaccggctggtg
tttatccacccggccacgggcgagccgctggcggtggaagcgccgctgcccgacgagtgc
gtcggattcctgcaacaattgcgtgaactgcatgccccggagtag

DBGET integrated database retrieval system