KEGG   Cupriavidus necator N-1: CNE_1c24980Help
Entry
CNE_1c24980       CDS       T01564                                 

Gene name
truA
Definition
tRNA pseudouridine synthase A (EC:5.4.99.12)
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
cnc  Cupriavidus necator N-1
Brite
Enzymes [BR:cnc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     CNE_1c24980 (truA)
Transfer RNA biogenesis [BR:cnc03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CNE_1c24980 (truA)
 Prokaryotic Type
    CNE_1c24980 (truA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2582387..2583205)
Genome map
AA seq 272 aa AA seqDB search
MNRIALGLHYDGAAFSGWQSQPHRNTVQDHLENAIERFAGVRLLTTVAGRTDTGVHALGQ
VIHLDTALEREPFSWVRGVNAFLPPSIALQWALPVDQGFHARFLAFERMYYYALYTGPHR
VPLVHGRAGYQMLPPGQRLDVDAMREAAACLVGEHDFSAFRAAECQAKSPVKTMYDVTIK
DDGNWVFLRFRASAFLHHMVRNLMGCLVAVGRGRYPAPWLAQVLAGRERKLAAPTFMPDG
LYLVGVKYPDPYQIPAADPSASLFHGVFDDAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcatcgctcttggcctgcactacgacggcgccgccttttccggctggcagtcg
cagccgcaccgcaataccgtgcaggatcacctggaaaacgccatcgagcgctttgccggg
gtgcgcctgctgaccactgtggcggggcgcaccgataccggcgtgcatgcgctcggccag
gtcatccacctggacacggcgctggagcgcgagccattttcctgggtgcgcggcgtcaac
gccttcctgccgccgtcgatcgcgctgcaatgggcgctgccggtggaccagggcttccac
gcccgtttcctggcgttcgagcgcatgtattactacgcgctctacaccgggccgcaccgc
gtgccgctggtgcacggccgcgccggctaccagatgctgccgccgggtcagcggctggat
gtcgacgccatgcgcgaggccgccgcgtgcctggtcggcgagcacgatttctccgccttc
cgcgccgccgaatgccaggccaagtcgccggtcaagaccatgtacgacgtcaccatcaag
gatgacggcaactgggtgttcctgcgctttcgcgccagcgccttcctgcaccacatggtg
cgcaacctgatgggctgcctggtggcggtggggcgcggacgctacccggcgccatggctg
gcgcaggtgctggccgggcgcgagcgcaagctggcggcgccgaccttcatgccggacggc
ctctacctggtcggcgtcaagtatcctgatccttaccagatccccgcggccgatccgtcc
gcgagcctgttccatggagtgttcgatgacgcagcctga

DBGET integrated database retrieval system