KEGG   Cupriavidus necator: CNE_1c24980Help
Entry
CNE_1c24980       CDS       T01564                                 

Gene name
truA
Definition
tRNA pseudouridine synthase A (EC:5.4.99.12)
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
cnc  Cupriavidus necator
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2582387..2583205)
Genome map
AA seq 272 aa AA seqDB search
MNRIALGLHYDGAAFSGWQSQPHRNTVQDHLENAIERFAGVRLLTTVAGRTDTGVHALGQ
VIHLDTALEREPFSWVRGVNAFLPPSIALQWALPVDQGFHARFLAFERMYYYALYTGPHR
VPLVHGRAGYQMLPPGQRLDVDAMREAAACLVGEHDFSAFRAAECQAKSPVKTMYDVTIK
DDGNWVFLRFRASAFLHHMVRNLMGCLVAVGRGRYPAPWLAQVLAGRERKLAAPTFMPDG
LYLVGVKYPDPYQIPAADPSASLFHGVFDDAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcatcgctcttggcctgcactacgacggcgccgccttttccggctggcagtcg
cagccgcaccgcaataccgtgcaggatcacctggaaaacgccatcgagcgctttgccggg
gtgcgcctgctgaccactgtggcggggcgcaccgataccggcgtgcatgcgctcggccag
gtcatccacctggacacggcgctggagcgcgagccattttcctgggtgcgcggcgtcaac
gccttcctgccgccgtcgatcgcgctgcaatgggcgctgccggtggaccagggcttccac
gcccgtttcctggcgttcgagcgcatgtattactacgcgctctacaccgggccgcaccgc
gtgccgctggtgcacggccgcgccggctaccagatgctgccgccgggtcagcggctggat
gtcgacgccatgcgcgaggccgccgcgtgcctggtcggcgagcacgatttctccgccttc
cgcgccgccgaatgccaggccaagtcgccggtcaagaccatgtacgacgtcaccatcaag
gatgacggcaactgggtgttcctgcgctttcgcgccagcgccttcctgcaccacatggtg
cgcaacctgatgggctgcctggtggcggtggggcgcggacgctacccggcgccatggctg
gcgcaggtgctggccgggcgcgagcgcaagctggcggcgccgaccttcatgccggacggc
ctctacctggtcggcgtcaagtatcctgatccttaccagatccccgcggccgatccgtcc
gcgagcctgttccatggagtgttcgatgacgcagcctga

DBGET integrated database retrieval system