KEGG   Cupriavidus necator: CNE_1c25140Help
Entry
CNE_1c25140       CDS       T01564                                 

Gene name
sdhD
Definition
succinate dehydrogenase(hydrophobic anchor subunit) (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cnc  Cupriavidus necator
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:cnc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cnc00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cnc00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:cnc00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2601156..2601521)
Genome map
AA seq 121 aa AA seqDB search
MANNNIGPKRLVVGAHYGLKDWLAQRVTAVIMVVFTVVLAIAFLLSNGASYEAWAGLFSN
QWMKIITFLTILSLLYHAWIGVRDIWMDYVRPMAVRLVLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaacaataatatcggtcccaagcgtcttgtcgtcggtgcgcactacggcctgaaa
gactggctggcgcagcgcgtcacggccgtgatcatggtggtcttcaccgtggtcctggcc
attgccttcctgctgtcgaacggcgcttcgtatgaagcgtgggcagggctcttctccaac
cagtggatgaagatcatcacgttcctgaccatcctgtcgctgctgtatcacgcctggatt
ggcgtgcgcgacatctggatggactatgtgcgtccgatggccgtgcgcctcgtgctgcaa
gttcttacgattctgtggctcgtcggttgcgcgggctacgctgctcagattctctggagg
gtgtaa

DBGET integrated database retrieval system