KEGG   Cupriavidus necator N-1: CNE_1c27080Help
Entry
CNE_1c27080       CDS       T01564                                 

Gene name
mmgC7
Definition
(GenBank) acyl-CoA dehydrogenase MmgC
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_2 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-ProteinID: AEI78023
UniProt: G0ET17
Position
1:complement(2808356..2809609)
Genome map
AA seq 417 aa AA seqDB search
MPSGQLDFIPAIGTADFTPQQARLLALANRLGRERFAARAATWDREASFPFANYADLREA
GLLALCVPRAFGGEGADFATYCMVGAEIGRFCGATALTYNMHICSTMWTGVLSDGIEMTP
DQRAEHEARRELHFARVVRDGAVYAQPFSEGSAAAAGKAPFGTTARKVDGGWVLNGRKIF
ASLSGAADYYGILCTEDRGDQHPDMRDTLYIAVPGKAEGLTVTGEWDPMGMRGTVSRTLL
LKDVFVPDHEQLMPRGVYYRAAQTWPAMFFTLSPTYLGVAQAAYDFTVQYLRGEVPGQPP
VKRRMYPTKQIAVAQMRIQLETMRSLFWRVIHEAKPNPTKDERLRLYAAHYTVMEGANDI
ARLAIRTCGGQSMLKDLPLERLYRDSRCGALMLPWTAELILDRMGRETLYESGERDE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgccatccggacagctcgacttcattcccgccatcggtacggcggactttaccccgcaa
caagcgcgcctgctggcgctggccaaccgcctgggccgcgaacgctttgccgcgcgcgca
gccacctgggaccgcgaggccagcttccccttcgccaactatgccgacctgcgcgaggcc
ggcctgctggcgctgtgcgtgccgcgggcgttcggcggcgagggcgcggactttgccacc
tactgcatggtgggcgccgagatcggccgcttctgcggggccacggcgctgacgtacaac
atgcatatctgctcgaccatgtggaccggcgtgctgtccgacggcatcgagatgacacct
gaccagcgcgccgagcacgaagcccggcgcgagctgcatttcgcacgcgtggtgcgcgac
ggcgccgtctatgcgcagccgttctccgaaggctccgccgccgccgcgggcaaggcgccg
ttcggcaccaccgcgcgcaaggtcgatggcggctgggtactgaacgggcgcaagatcttc
gcctcgctgtcgggcgcggccgactactacggcatcctgtgcaccgaggaccgcggcgac
cagcatcccgacatgcgcgacacgctctacattgccgtgcccggcaaggcggaagggctg
accgtgaccggcgagtgggacccgatgggcatgcgcggcacggtgtcgcgcacgctgctg
ctcaaggacgtgttcgtgcccgaccacgagcagctgatgccgcgcggcgtctactaccgc
gcggcgcagacctggccggcgatgttcttcacgctgtcgccgacctacctgggcgtggcc
caggccgcctacgactttaccgtgcagtacctgcgcggcgaggtgccgggccagccgccg
gtcaagcgccgcatgtacccgaccaagcagatcgcggtggcgcagatgcgcatccagctg
gaaaccatgcgatcgctcttctggcgcgtgatccatgaggcgaagcccaatccgaccaag
gacgagcgcctgcgcctgtacgccgcgcactacaccgtgatggaaggcgccaacgacatc
gcccggctggcgatccgcacctgcggcgggcagtcgatgctcaaggacctgccgctggag
cggctctaccgcgactcgcgctgcggcgcgctgatgctgccctggaccgccgagctgatc
ctggaccgcatggggcgcgagaccctgtacgaatccggcgagcgcgacgaatga

DBGET integrated database retrieval system