KEGG   Cupriavidus necator N-1: CNE_1c27240Help
Entry
CNE_1c27240       CDS       T01564                                 

Definition
(GenBank) phage-like integrase
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Arm-DNA-bind_3
Motif
Other DBs
NCBI-ProteinID: AEI78039
UniProt: G0ET33
Position
1:2824216..2825430
Genome map
AA seq 404 aa AA seqDB search
MTSKAKLTKAYVDSCSTPGFYWDTALTGFGLRISGTTKTYIVQARIAGRDTRRSIGRHGV
LTAEEARKKAREALALMADGTDPKAAARARKIEGISLTQVFNDYLTQHPLKPRTQYDYNG
FMARAFADWAMKPLTTITADMVEKRHAAIVSRSGGAQADGAMRFLRALFNYAEGKYEKVT
GEPLVSSNPTKRLRALKLWARPPRRESYVREEQLARWHQSVMALGNTLASDDADTMRDYL
LFVLFTGLRRSESMSLRWEYVDLEGRRFTIPSENTKNKRSHPLPLTTLTLEILQRRWAQR
SNDYVFPGRGKTGHLVEPKKAIAKVADDSGIPFTLHDLRRTFATCASTVIDNQSTIKRLM
NHLTGGQDVTEGYKQGVERLREPAQRVTNYMLQLIANGLPASTT
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccaaggccaagctcacaaaagcgtacgttgatagctgcagcaccccaggcttc
tattgggataccgccctcacagggtttgggctgcgcatcagtggcacgaccaagacctac
atcgtacaggctcgtatcgccgggcgggacacgcgtcgcagcattggccgacacggcgtt
ctcactgcagaggaagcccgcaaaaaggcgcgtgaagcgctggcgctcatggcagacggc
accgacccgaaggccgccgcgcgggcgcgcaagatcgagggaatatccttgacgcaggta
ttcaacgactacctgacacaacaccctctgaaaccacggacgcagtacgactataacggc
ttcatggctcgcgcgttcgcggattgggccatgaagccacttaccaccatcaccgccgat
atggtcgagaagcgccatgctgccatagtcagtcgcagtggaggggcgcaagctgatgga
gcaatgcggttcttgcgcgcgctcttcaactatgcggaagggaaatatgaaaaggtcacc
ggtgagccgctagtctcatcgaacccaacaaagcggctacgggcactgaagctgtgggca
cgccctccccggcgagaatcgtacgtccgggaggaacagcttgctcgctggcatcaaagc
gtcatggcgctcggcaatacccttgcatcggacgacgccgacacgatgcgggactatctt
ctgttcgtcctcttcactggcttacggcgatccgagtcaatgtccctacgctgggagtat
gttgatctggagggtaggcgattcacgatcccatccgaaaacacgaaaaacaagcgaagc
caccctctccctttgacaacgctgacgctcgaaatcctacaacgtcgctgggctcagcgt
tccaatgactatgtgtttccaggccgggggaaaactggacatcttgtggagcccaagaag
gcaatagccaaggtcgcggacgattccggtatccccttcactctccacgatctccgccga
acttttgccacatgcgctagtaccgttatcgacaatcagtcgaccataaagcgcctcatg
aaccacctaactggcggtcaggatgttaccgagggatacaagcaaggggtggagcgcttg
cgagaaccagctcaacgagtcaccaactacatgttgcaactgattgcaaacggcctgccg
gcatccacaacatga

DBGET integrated database retrieval system