KEGG   Cupriavidus necator N-1: CNE_1c27400Help
Entry
CNE_1c27400       CDS       T01564                                 

Gene name
pilV2
Definition
(GenBank) type IV pilus assembly protein PilV
  KO
K02671  
type IV pilus assembly protein PilV
Organism
cnc  Cupriavidus necator N-1
Brite
Secretion system [BR:cnc02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   CNE_1c27400 (pilV2)
Bacterial motility proteins [BR:cnc02035]
 Pilus system
  Pilus assembly proteins
   CNE_1c27400 (pilV2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2840472..2841101
Genome map
AA seq 209 aa AA seqDB search
MGQRCRGAAGFAMLEALVAIVVLAVGVLGVASLLLNSSRFTQQASYDTTAMQLATEMAER
MRANPAVSQTGAAAEAITPNRYFIDTATGQPPALTAANSPYAIACSGTAAGCAQQLADFD
VAEFWERVSTGLPGGRAVICRDMVAYDQTTGFSWGCTPSATGRPDDAPIVIKIGWISRLA
AKTVAARVDMSDMGTRPQVVIVATQGTVN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaacgctgccgcggggcagccggctttgccatgctcgaagcattggtggcaatt
gtcgttctggcggttggcgtgctcggcgtcgccagcctgctgctgaattcatcccgcttc
acgcaacaagcttcctacgacaccactgccatgcagctggccaccgagatggccgagcgc
atgcgtgccaatcctgccgtctcgcaaaccggcgcggcggcggaagccatcaccccgaac
cgctacttcatcgacaccgccaccgggcagccacccgcgctcacggcagcaaacagcccg
tacgcgatcgcctgctcgggcacggcggccgggtgcgcgcagcaactggcggatttcgat
gtcgccgagttctgggagcgtgtcagcacaggcctgcctggcggacgcgccgtgatttgc
cgggacatggttgcgtacgaccagaccaccggcttctcatggggatgcacgccatcggcc
actggccgcccggacgacgcaccgattgtcatcaagatcggatggatctcgcggcttgcc
gccaaaaccgtcgcggcacgggtcgacatgtccgacatgggcacgcgcccccaggtggtc
atcgtggccacgcagggtacggtgaactga

DBGET integrated database retrieval system