KEGG   Cupriavidus necator N-1: CNE_1c27420Help
Entry
CNE_1c27420       CDS       T01564                                 

Gene name
pilX
Definition
(GenBank) type IV pilus assembly protein PilX
  KO
K02673  type IV pilus assembly protein PilX
Organism
cnc  Cupriavidus necator N-1
Brite
Secretion system [BR:cnc02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   CNE_1c27420 (pilX)
Bacterial motility proteins [BR:cnc02035]
 Pilus system
  Pilus assembly proteins
   CNE_1c27420 (pilX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PilX PilX_N
Motif
Other DBs
NCBI-ProteinID: AEI78056
UniProt: G0ET50
Position
1:2842134..2842742
Genome map
AA seq 202 aa AA seqDB search
MNARTARPNPRGIALITALVMLLIISVIAIAGARLAIGSKRMASNQRDRDLAQQAAEAAL
LDAEIDIQGVAAPTSRSAIFSGTTMNVLPFVAGCNTGVTGASPFQGLCDPVLDGTPNWLT
VDFSQTGANARTTAYGTFTGRRFPTATGGLLPAALPRYIIEPINDMSPGASEGAYIFRVT
AVGFGANPATRVMLQSYYRKGE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcaccgcgcgacccaacccgcgtggcatcgcgctgatcaccgccctggtg
atgctgctgatcatcagcgtcatcgccatcgccggcgcccggctggccattggcagcaag
cgcatggcatcgaaccagcgcgaccgggacctggctcagcaagcggccgaggcagccttg
ctggatgcagaaatcgacatccagggtgtcgccgcgccaaccagccggtcggccatcttc
tccggcaccacgatgaatgtcctgccgttcgtggcgggctgcaatacgggcgtgacaggc
gcctcacccttccagggactgtgcgacccggtgctcgacggtacgccgaactggctcacc
gttgacttcagccagactggcgccaacgcacgcaccaccgcctatggcaccttcaccggc
cgcaggttcccgaccgcgaccggcgggctgctgcctgccgcgctgccgcgctacatcatc
gagccgatcaacgacatgtcgccaggcgcgagcgagggcgcatacatcttccgcgtcacg
gccgtcggctttggcgcaaacccggcgacccgggtcatgttgcagtcgtactaccgaaag
ggggaatga

DBGET integrated database retrieval system