KEGG   Cupriavidus necator N-1: CNE_1c27430Help
Entry
CNE_1c27430       CDS       T01564                                 

Gene name
pilY2
Definition
(GenBank) type IV pilus assembly protein PilY
  KO
K02674  type IV pilus assembly protein PilY1
Organism
cnc  Cupriavidus necator N-1
Brite
Secretion system [BR:cnc02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   CNE_1c27430 (pilY2)
Bacterial motility proteins [BR:cnc02035]
 Pilus system
  Pilus assembly proteins
   CNE_1c27430 (pilY2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Neisseria_PilC PQQ
Motif
Other DBs
NCBI-ProteinID: AEI78057
UniProt: G0ET51
Position
1:2842778..2846620
Genome map
AA seq 1280 aa AA seqDB search
MSRIRKFLFAAMAALLSLPAGALLAATEQSSLATVKIAQAPLYGRNQNIHPNLLLTLSVE
FPTVGAAYRSGTYSPATEYIGYFNPLKCYNYSGGDSNGYFVIAGDANTADHTCAGQFSGN
FMNWATASAIDMLRYALTGGDRVVDTATQTILQRAVLQDSFFNSSSYFPRKTYDKASSVT
PFTSRTLYITSCGNKVFFGDSTESGASCASPGKYKNQGTYLVRVQVCDASEAKSRTDLCK
LYRTGYKPAGEMQRNADKVRFGAFGYLNDSANTRYGGVLRAPLKYVGPNTVDSNFNQASN
LRREWDDDGVFIQNPESASENISGVINYLNQFGRSGAYKSLDPVGELYYESIRYLQGRQP
TPEAIDNASAYKDGFPVYTQWTDPILASCQKNYVLAIADINTHWDRYIPGNGRTTYLSGG
KPVSANDPARPADAMSKFSKYSFDVMTWTQAVADLESSGTSGNSRPDASLANLAGADTGS
SGHGTYYMAGVAYWAHTYGFRPDMPELRVTTFSIDVNENGNGSVGDEQRRSQMYLAAKYG
GFDDQNGDGNPFRTKGASGTTVTSNAEWESSGGSNVPANWFLAGQPAAMIASIKKVFAQI
VNAAGTLSGVALTSSQVASDTLLFTPGFDQRWNGRLSALAVTNDPNTGVQISNTETWEAG
KVLTARTAARNLLTWVPSGTVDNAGTGAGAGATFEWKSLNAAQKAALKIVPTETDTVAQS
RLSYLRGERSQEQATGSTGTMRLRDSLLGDIVNSGPVYMAAPSGTIAESDYTTFYKAHSR
RTAAVFIGANDGMLHAFNAANGSELFAYVPNAVFANLTQLTSPSYIHRPYVDATPAVAEA
RVGNAWQTVLVSGMGGGAQGLFALNVSDPASVGTGNVLWEFTDKDDADMGNVMSPPQIVK
LFAGKDSDNKPVYKWFAMTGNGLNANDADGASNPAAPSVLFIVALDKPAGTPWQLGVNYW
KISMAADATASIANGLSSPALVRLTDGQTVAAYAGDLQGRLWKFILNGGPSTWNAAGALP
YYGGGNYGRPLFQARDASGKPQPITVQPKWVYAPGGYMVVFGTGKYLEPADTITTGTLTR
NAMYGIYDAGGSQSIADRSMLNPVTLTRNSKGAYEYSSRSYSLGSKTGQKAGWYFDFPGN
GERQVTALVPAYGKIWFNSLMTGDDLCGASSNSGRYQINALTGMPATGTSTGDPSTFGIL
GAPVLIQTRTTVDPQRNAVGQITTLKFIDVFSFGASGGGRSADASLSSRPLVSGNTATDG
GHPTTGRLGWREIRNFGAAK
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatccggaaattcctgttcgcggccatggctgcgcttctcagcctgcccgcc
ggcgcgttgcttgccgcgacagaacagagcagcctcgcgaccgtcaagatcgcgcaggca
ccgctgtacggccgcaatcagaatatccaccccaacctgctgctgacgctctcggtagag
ttccccacggttggggcagcctatcgctccggcacgtattcaccggccaccgaatacatc
ggctacttcaatccgctcaagtgctacaactacagcgggggcgacagcaacggctatttt
gtcattgctggcgatgccaacacggccgatcacacatgcgcgggccagttcagcggcaac
ttcatgaactgggccacggcctcggccatcgatatgctgcgatacgcgctgaccgggggc
gaccgcgtggttgacaccgccacgcagaccatcctgcaacgtgccgtgctgcaggacagt
tttttcaacagcagctcctacttcccccgcaagacttacgacaaggcgtcctcggtcacg
cctttcaccagccggaccctttacatcacttcatgcggcaacaaggtgttcttcggggac
agcaccgaatccggcgccagctgcgcgagccccggcaagtacaagaaccagggcacctac
ctggtacgggtgcaagtctgcgatgcaagcgaagccaagtcccgcaccgatctctgcaag
ctgtatcgcaccgggtacaagccggctggtgaaatgcagcgcaacgccgacaaggtccgc
tttggcgcgtttggctatctgaacgacagtgccaatacccgttatggcggtgtcttgcgc
gcgcccctgaagtatgtggggccaaacactgtcgacagcaatttcaatcaagccagcaac
ctgcgccgggaatgggatgacgacggcgtattcatccagaaccccgagagcgcgtcagag
aacatcagcggtgtcatcaattacctgaatcagttcgggcgttccggcgcctacaagtca
ttggatcccgtcggcgaactctactacgagagcatccgctacctgcaaggccgacaacca
acgcccgaagccatcgacaacgccagcgcgtacaaggatggatttccggtctacacgcaa
tggacagaccccatccttgccagttgccagaagaactacgtccttgccattgccgatatc
aacacgcactgggaccgatacatccctggcaacggcaggacgacctacctctccggtggc
aagccggtctctgccaatgacccggcaaggccggcagacgcgatgtcgaaattcagcaag
tacagcttcgatgtcatgacctggacgcaggcggtggccgatcttgagagttcgggaaca
tctggcaacagccgccccgatgcctcgctcgccaacctggctggcgccgacaccggctcc
agcggccacggcacctactatatggccggcgtcgcgtattgggcccatacctacggcttc
cgcccggatatgccggaattgcgagtcaccacgttcagcatcgacgtcaatgagaacggg
aacggcagcgtgggcgatgaacagcgccgcagccagatgtacctggcggcaaagtacggc
ggctttgacgaccagaacggtgatggcaatccgttccgcaccaagggggccagcggcacc
accgtcaccagcaatgccgaatgggaatcgtcgggcggatcgaatgtccccgccaactgg
ttcttggccgggcagccggccgccatgattgcttccatcaagaaggtcttcgcgcaaatc
gtcaatgcggccggcacattgtctggcgtggcactgacctcttcccaggtcgcgagcgac
accctcctgttcacccccggattcgaccagcgctggaacgggcgcctgtcggcactggcg
gtgaccaatgatcccaacaccggcgttcagatctccaacaccgaaacctgggaggccggc
aaggtgctgactgcgcgcaccgctgcccgcaatctgctgacctgggtcccgtcgggcacg
gtcgacaatgcaggaaccggcgcgggtgcgggcgccaccttcgaatggaaatctctcaac
gccgcgcagaaggccgcactgaagatcgtgccgacagagactgacaccgtagcccagagc
cggctcagctacctgcgtggcgagcgcagccaggaacaagccaccggcagcacggggacc
atgcgcttgcgcgactcactgctgggcgacatcgtcaattcgggccccgtctatatggcg
gccccgtccgggaccatcgcggaaagcgactacaccacgttctacaaggcccacagccgg
cgtactgccgccgtatttatcggcgccaacgatggcatgctccacgccttcaatgcggcc
aatggctctgaactgtttgcctacgtgccaaacgcagtgttcgccaacctgacccagctg
acctcgccgagctatatccatcggccgtacgtggacgccacgcctgccgtggcggaagcc
agggtgggcaacgcctggcagaccgtgctggtctctggcatgggtggcggcgcgcaaggc
ctctttgcgctgaatgtcagcgatcctgccagcgtcggaaccggcaatgtattgtgggag
ttcacggacaaggatgatgccgacatgggcaacgtcatgtcgccgccccagatcgtcaag
ctgtttgccggcaaggactccgacaacaagcctgtgtacaagtggtttgccatgacgggc
aacggcctgaatgccaacgatgcggatggcgcgagcaatccggctgcgccttcggtgctg
ttcatcgtggcactggacaagccggccgggacgccgtggcaactgggcgtcaattactgg
aagatctcgatggcagcggacgccaccgccagcattgccaacgggctgagctcgccggcg
ctggtgcggctgaccgacgggcagaccgtcgccgcctacgccggcgacctccagggccgc
ctctggaagttcatcctgaatggcggcccatccacctggaacgctgccggggcactaccg
tactacggcggcggcaactacggccggccgctgttccaggcccgcgatgccagcggaaaa
ccgcagccgatcacggtccagcccaaatgggtctacgcgcccggaggctatatggtggtg
ttcggcaccgggaagtacctggagcctgccgacaccatcaccaccggcacgctgacccgg
aacgccatgtacggcatctacgatgccggaggctcccagtcgattgcagaccgcagcatg
ctgaacccggtcaccttgacccgcaacagcaagggcgcttacgaatattcgtcacgcagc
tatagcctcggctcaaagacgggacagaaggcggggtggtactttgatttcccgggcaac
ggagaacgccaggtcaccgcgctcgtgccggcttacggaaagatctggttcaattcgctg
atgaccggtgatgacctttgcggtgcctccagcaacagcggccgctaccagatcaatgcg
ctgaccggcatgcccgccacggggacatcgaccggcgatccctccaccttcggcatcctg
ggtgcgccggtgctgatccagaccaggaccacggtggatccgcaacgcaatgctgtcggc
cagatcactacgctgaagttcatcgacgtgttttcgttcggcgcatcgggtggcggccgc
agcgcagacgcgtcgttgtccagcaggccgcttgtgtccggcaacacggccaccgacggg
gggcatcccaccaccgggcgccttggctggcgcgagattcgcaatttcggagccgcaaaa
tga

DBGET integrated database retrieval system