KEGG   Cupriavidus necator N-1: CNE_1c27470Help
Entry
CNE_1c27470       CDS       T01564                                 

Gene name
ribD
Definition
(GenBank) riboflavin biosynthesis protein RibD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00740  Riboflavin metabolism
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CNE_1c27470 (ribD)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CNE_1c27470 (ribD)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     CNE_1c27470 (ribD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     CNE_1c27470 (ribD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C dCMP_cyt_deam_1 MafB19-deam Acyl-CoA_dh_M
Motif
Other DBs
NCBI-ProteinID: AEI78061
UniProt: G0ET55
Position
1:2848761..2849876
Genome map
AA seq 371 aa AA seqDB search
MFSDTDHAAMQQALALAARGMFNTTPNPRVGCVLVKDGQVIGQGFTQPAGQDHAEIQAMK
DALARGLDPAGATAYVTLEPCSHFGRTPPCADALVRAGVARVVAAMEDPNPSVSGRGLQR
LREAGVDVRCGLLEKEARDLNIGFVSRMTRGLPWVRVKVAASMDGGTALHDGTSQWITGQ
AARDDGHAWRARACAILTGIGTVRDDNPALTVRAIATLRQPQRVLVDSRLEVPLDARILT
PDTGEFAKPVLVFCAVEDRQRQRALESRGAEVVVLPNPHGKVELRRMLEELGRRGINELH
VEAGFKLNGSLVREHCADELLIYLAPKLLGDAQGMFNLPPLARLQDAAQFRWHEIRQIGD
DLRLIARRNDA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgttttccgataccgaccacgccgccatgcaacaggcccttgcgctcgccgcgcggggc
atgttcaacaccacgcccaacccgcgcgtcggctgcgtgctcgtcaaggatggccaggtc
atcggccaggggttcacccagccggccgggcaggatcatgccgagatccaggcgatgaag
gacgcgctggcgcgcgggctggacccggccggcgccaccgcctatgtcacgctggagccg
tgcagccatttcgggcgcacgccgccgtgcgccgatgcgctggtgcgcgcgggcgtggcg
cgcgtggtggcggccatggaagaccccaacccttcggtgtccgggcgcggcctgcagcgg
ttgcgcgaggccggcgtcgacgtgcgctgcggcctgctggaaaaggaagcgcgcgacctg
aatatcggctttgtctcacgcatgacgcgcgggctgccgtgggtgcgcgtcaaggtggcg
gcatcgatggacggcggcaccgcgctgcatgacggcaccagccagtggatcaccggccag
gccgcgcgcgacgacggccatgcctggcgcgcacgtgcgtgcgcgatcctgaccggcatc
ggcaccgtgcgcgacgacaaccccgcgctgacggtgcgggccatcgccacgctgcgccag
ccgcagcgggtgctggtcgattcgcgactggaggtcccgttggacgcgcggatcctaacg
ccggacactggcgagttcgccaagccggtgctggtgttctgcgcggtggaggaccggcag
cgccagcgcgcactggaaagccgtggcgccgaagtcgtggtcctgcccaacccgcacggc
aaggtcgagttgcgccgcatgttggaagaactcggccggcgcggcatcaacgagctgcac
gtggaggccggcttcaagctcaacggttcgctggtgcgcgagcactgcgccgacgagctg
ctgatctacctcgcgcccaagctgctgggcgatgcccagggcatgttcaacctgccgccg
ctggcgcggctgcaggacgccgcgcagttccgctggcatgagatccggcagatcggcgac
gacctgcggctgatcgcccggcgcaacgacgcgtag

DBGET integrated database retrieval system