KEGG   Cupriavidus necator N-1: CNE_1c27510Help
Entry
CNE_1c27510       CDS       T01564                                 

Definition
(GenBank) hypothetical membrane protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2851593..2852180
Genome map
AA seq 195 aa AA seqDB search
MLTLLYFRLNDIAAARRAHAQLGELAATLARIDGPWFFLRDDQPAEGLPSPHAAQITYRN
EVAAAGLVAGALLVAWIVFRYGTPANAAAGFMAYLGGMALGAVIGRWLGSVIGARVMRAG
LRRQKRQMTAGQLMMICACDPHAKGRLCEIAQDAGAAAIDTQHSRLHLRGWLTDRHWPAW
LSGHGQRAVPQRKQA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctactgtatttccggctgaacgacattgccgcggcaaggcgcgcgcacgcg
cagcttggcgagctggccgcgactctcgcacgcatcgacggcccttggttcttcctgcgc
gacgaccagccggccgaaggcctgccctcgccccacgcggcgcagatcacctatcgcaat
gaagtcgcggcggccggcctggtcgccggcgcactgctggtggcctggatcgtgttccgc
tacggcacgccggccaacgcggccgcgggcttcatggcctacctcggcggcatggcgctt
ggcgccgtgatcggccggtggctgggcagcgtgatcggtgcccgggtcatgcgcgccggc
ctgaggcggcagaagcggcaaatgacggcaggccagctgatgatgatctgcgcgtgcgac
ccgcacgcaaaggggcggctctgcgagatcgcccaggatgccggcgccgccgccatcgac
acacagcatagccggctgcacctgcgcggctggctgacggaccgccactggcccgcatgg
ctttcaggccatggccagcgtgctgtcccacaaaggaaacaagcatga

DBGET integrated database retrieval system