KEGG   Cupriavidus necator N-1: CNE_1c27590Help
Entry
CNE_1c27590       CDS       T01564                                 

Gene name
acsA4
Definition
(GenBank) acetoacetyl-coenzyme A synthetase AcsA
  KO
K01907  
acetoacetyl-CoA synthetase [EC:6.2.1.16]
Organism
cnc  Cupriavidus necator N-1
Pathway
Valine, leucine and isoleucine degradation
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CNE_1c27590 (acsA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNE_1c27590 (acsA4)
Enzymes [BR:cnc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.16  acetoacetate---CoA ligase
     CNE_1c27590 (acsA4)
Lipid biosynthesis proteins [BR:cnc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CNE_1c27590 (acsA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2859778..2861802
Genome map
AA seq 674 aa AA seqDB search
MSTPAPLTEGNLMWTPSAAFRDSSQVARFMHWLRAERGLAFDDYDSLWQWSVTELEAFWD
AVRAYFDVRFDTPATQVLDRRTMPGARWFEGATLNYVQQVFRHAGAGSARQRTAIRHAGE
AQPLADVSWDMLQAQVASLAHALRQMGVQRGDRVAGYLPNIPATIVAFLATASLGAVWSG
CAPDMGQVAVIDRFRQIGPKVLIAVDGYRYGGKVYDRTPVLADLIAALPSLTDLVLVPQI
GSPAAPPAGVRAHAWQEVLAHDVPLAIEPVPFDHPLWIVYSSGTTGMPKPIVHGHGGIVI
EQLKLMAFHNNLGTDDVFHWYSSSGWIMWNAQVAGLLLGTTIALYDGNPAWPDAGVLWRF
VDDAGVTLFGAGAAFFINCMKAGIEPARIADVSRLRGLGSTGSPLPVEAYDWIYRHVRED
IWLVPMSGGTDFAGSFVAGCPLLPVYSGEMQCRCLGAKVEAFDDNGQPLLDAVGELVCTE
PMPSMPLYLWGDADGKRYRDSYFDTYPGVWRHGDWIKITKRGGAVIYGRSDATINRHGIR
MGTSELYRVVEDLPEVLDSMVVDLEYLGRESYMPLFVVLREGLVLDDALRDTLRLRIREA
LSSRHVPNEIVQAPGVPRTLSGKKMEVPIKKLLLGHAPQGIANRDAMANPDTLDWYFDYA
ERFLKARQADPATA
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccgcccctctgaccgaagggaacctgatgtggacgccctccgcggcgttc
cgcgacagcagccaggtcgcgcgcttcatgcactggctgcgggccgagcgcggcctggcc
tttgacgactacgacagcctctggcagtggtcggtcaccgagctggaagccttctgggac
gccgtgcgcgcctatttcgacgtacgcttcgacacgcccgccacgcaggtgctggaccgc
cgcaccatgccgggcgcgcgctggttcgagggtgccacgctgaactacgtgcagcaggta
ttccgccacgccggtgcgggcagcgcccgccagcgcaccgcgatccgccatgccggcgag
gcccagccgctggccgatgtcagctgggacatgctgcaagcgcaggtggcgtcgctggcg
catgcgctgcgccagatgggcgtgcagcgcggcgaccgcgttgccggctacctgcccaat
atccccgccaccatcgtcgccttcctggccacggccagcctgggtgcggtctggtcgggc
tgcgcgccggacatgggccaggtggcggtgatcgaccgcttccgccagatcgggcccaag
gtgctgatcgccgtcgacggctaccgctatggcggcaaggtctacgaccgcaccccggtg
cttgccgacctgatcgccgccctgccctcgctgaccgacctggtgctggtgccgcagatc
ggcagccctgcagcgccgcctgccggcgtgcgcgcgcatgcctggcaggaggtgctggcg
cacgacgtgccgctggcgatcgagccggtgccgttcgaccatccgctgtggatcgtctat
tcgtccggcaccaccggcatgcccaagccgatcgtgcatggccatggcggcatcgtcatc
gagcagctcaagctgatggccttccataacaacctgggcacggacgatgtcttccactgg
tacagcagcagcggctggatcatgtggaacgcgcaggtggccgggctgctgctgggcacc
accatcgcgctgtatgacggcaacccggcctggcccgacgcgggcgtgctgtggcgcttt
gtcgacgacgccggtgtgacgctgttcggcgccggcgcggccttcttcatcaactgcatg
aaggccggcatcgaaccggcacgcatcgccgacgtgtcgcgcctgcgcgggctcggctcg
accggttcgccgctgccggtggaggcctacgactggatctaccgccatgtgcgcgaagac
atctggctggtgccgatgtcgggcggcaccgactttgccggctccttcgtcgccggctgc
ccgctgctgccggtctattccggcgagatgcaatgccgctgcctgggcgccaaagtggag
gccttcgacgacaacggccagccgctgctcgacgcggtgggcgaactggtctgcaccgag
ccgatgccgtcgatgccgctctacctgtggggcgacgccgacggcaagcgctatcgcgac
agctatttcgacacctatcccggcgtctggcggcatggcgactggatcaagatcacaaag
cgcggcggcgcggtgatctacgggcgctcggacgccaccatcaaccgccacggcatccgc
atgggcaccagcgagctgtaccgcgtggtggaagacctgccggaagtgctcgacagcatg
gtggtcgacctggaatacctgggccgcgagtcctacatgccgctgtttgtggtgctgcgc
gaaggcctggtgctggatgatgcgctgcgcgacaccctgcgcctgcgcatccgcgaagcg
ctgtcctcgcgccacgtgcccaacgagatcgtgcaggcacccggcgtgccgcgcacgctg
tcgggcaagaagatggaagtgccgatcaagaagctgctgctcggccatgcgccacagggc
atcgccaaccgcgatgcgatggccaacccggacacgctcgactggtacttcgactacgcc
gaacgcttcctgaaggcacggcaggccgaccccgccacggcgtaa

DBGET integrated database retrieval system