KEGG   Cupriavidus necator N-1: CNE_1c27650Help
Entry
CNE_1c27650       CDS       T01564                                 

Gene name
proP3
Definition
(GenBank) proline/betaine transporter ProP
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: AEI78079
UniProt: G0ETN0
Position
1:complement(2866475..2867845)
Genome map
AA seq 456 aa AA seqDB search
MNPQQEPPVNPLSVPGGVLPAPVRTLAARDYKTLGLAALGGTLEFYDFVIYVFFVTVLGA
LFFPPNMPDWLRQLQAFGIFAAGYLARPLGGIVIAHFGDRLGRKRMFTLSILLMAAPTLM
IGLLPTYASIGVAAPLLLLAMRVLQGAAIGGEMPGAWVFVGEHMPSRHYGFGIGTLTSGI
TGGILLGSLVAVAINRHYSPEQVSDFAWRIPFILGGVFGLVSVYLRRFLHETPVFRELAS
RSNLARELPIRTVLREHRSASLFVALLTWVLSTSIVVVVLYTPAYLQKVHHIPAALALET
NAFATLALTIGCVIVGWASDRIGTRAVMLIGWGGLFVTAYLFYDSLPGTPGTLFWHYGLL
GLFVGTIATVPIAGVRAFPAPVRFTGLSFAYNMSYAVFGGLTPMILTLWLQHDAMAPAHY
VAVLAAVGFLLAFWPLARCGHAMRNGVASMAGHVSR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccacaacaggaaccacctgtgaatcccctgagcgtacctggcggcgtcttaccc
gctccggtacgcacgctggctgctcgcgactacaagaccttgggtcttgccgccctcggc
ggcacgcttgaattctatgacttcgtcatctacgtgttcttcgtcacggtgctgggcgcg
ctattcttcccgcccaacatgcctgattggctgcgacaactgcaggcgttcggcattttc
gccgccggctatctggcacgcccgctgggcggcatcgtgatcgcccactttggtgaccgg
cttggccgcaagcgcatgttcacgctgtcgatcttgctgatggcagcgcccacgctgatg
atcggactgctgcccacctacgccagcatcggcgtcgcggcgccactgttgctgctggcg
atgcgcgtgctgcagggcgcggccatcggtggcgagatgcccggtgcctgggtgtttgtc
ggcgaacacatgccgagccggcattacggtttcggtatcggcacgctgacctcgggtatc
accggcggcattttgctgggttcgctcgttgccgtcgccatcaatcgccattactcgcca
gagcaggtgagcgatttcgcctggcgcatccccttcatcctgggcggcgtgtttggactg
gtatcggtgtatctgcgccggtttctgcacgagacacccgtgttccgcgagttggctagc
cgcagcaatctggcgcgcgaactgccgatccgcaccgtgctgcgcgagcaccgctcggcc
agcctgttcgtcgcattgctgacctgggtactttctacctctatcgtcgtggtggtgctg
tacacgcccgcctacctacagaaggtgcaccacattcccgccgcgcttgcgctcgagacc
aatgccttcgctacgctcgcgctgaccatcggctgcgtgatcgtcggttgggcgagcgac
cgcattggcacgcgcgccgtcatgctgatcggctggggtggcctgttcgtgaccgcttac
ctcttctacgacagcctgcccggcacgcctggcacgctgttctggcactacggactactg
ggtctgttcgtcggcaccatcgccactgtgccgattgccggcgtgcgtgcctttccggca
ccggtgcggttcaccggtctctcgtttgcctacaacatgtcttacgcagtttttggcggc
ctcacgccgatgattctcacgctgtggctgcagcacgacgcaatggcgccggcgcactat
gtggcagtgctggccgctgtcggattcttgcttgcgttctggcccctcgccaggtgcggc
catgccatgcgcaatggcgtggccagcatggctggccacgtcagtcgataa

DBGET integrated database retrieval system