KEGG   Cupriavidus necator N-1: CNE_1c27770Help
Entry
CNE_1c27770       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CENP-F_leu_zip Macoilin APG6 YabB IncA DUF4407 Golgin_A5
Motif
Other DBs
NCBI-ProteinID: AEI78091
UniProt: G0ETP2
Position
1:complement(2881769..2883235)
Genome map
AA seq 488 aa AA seqDB search
MKSNPLLKWLLIPMVLLMVFAGIRLFSNDHGAEPARPDRANPLSPEEMKALGIEGDTPRD
TVATLVAQVKQLRNELQAALNDNKDQKAENERMRVRESAIDQSIQTALEGERGRVQQERD
QIANDRQQTQDRLQDLQRRLDGLSGEGGQPDLPIGLGLEEGDGKHRGGARKSGGMHWVEP
DDATPVKSGDVRSGPNLPTSFGPAQRTLTDMAENTASAAAEAVSSAAETYAKPIYTVPSN
STLIGSIAMTALIGRVPIDGTVNDPYPFKVLIGPDNLTANGIDIPDVAGAVVSGTASGDW
TLSCVRGQVRSVTFVFQDGTIQNVPQKSSRSQGATGDQASSTGMDGSAVRGSLGWISDPH
GVPCVSGERRSNAQQYLGSQALITAAGAGAASLIKSDTGSVAVVSNSNGSLGTVGISGNE
AMGRILAGGVRDMADWVNKLYGQAFAAIYVQPGAKVAVHLEQPLNIDYDVKGRRVNHRIG
EAHASDLD
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaatcccctcctcaagtggttgctgatcccgatggtgctgttgatggtcttc
gctggcatcaggctcttctcaaatgatcatggtgccgagcccgccaggcccgatcgtgcc
aatccgctctcgcctgaagagatgaaagccttgggtatcgagggcgatacgccgcgcgat
accgttgccacgctggtcgcccaggtcaagcaactgcgcaacgaactacaggcagcgctc
aacgacaacaaggaccagaaggccgagaacgagcgcatgcgtgtccgtgagagtgcgatt
gaccaaagcatccagaccgcattggagggcgagcgcggccgcgtgcaacaggagcgtgat
cagatcgcaaacgatcgtcagcagacgcaggaccggttacaagacttgcagcggcgcctc
gatgggctttccggcgagggcgggcagcccgacctgcccatcgggctgggcctggaggag
ggcgatggcaagcacaggggcggtgcgcgcaagagtggcggcatgcactgggtggaacca
gatgacgcaacgcctgtcaagagtggcgatgtacgtagcggcccgaatctgcccaccagc
ttcggacccgcgcagagaactctgacggatatggctgaaaacactgcgagcgccgccgct
gaggctgtcagcagcgccgcagagacctacgccaagccgatctacacggtgccgtccaac
tcgacactcattgggtcgattgccatgacagcgttgatcggacgtgtgccgatcgacggt
acggtcaacgacccgtatcccttcaaggtgctgatcggtccggacaaccttaccgccaac
ggcatcgatattcccgacgtagccggtgcagtggtgagcggcaccgcctcgggcgactgg
acactttcatgcgtgcgcggccaggtccgcagcgtgacgttcgttttccaagacggaact
atccaaaacgtgccgcagaagagttcgcgcagccagggcgccaccggtgaccaggctagc
agcaccggcatggacggcagcgcggtgcggggtagcttgggctggatcagcgatccccac
ggcgtcccctgcgtctccggcgagcgtcgcagtaacgcgcaacagtacctcggttcgcag
gcgttgattaccgcggccggcgcaggcgcggcctcgctcatcaagtcggacaccggcagt
gtagccgtggtctccaacagcaacggctcgcttggtacggtcggcatttcaggcaacgag
gccatgggccgcattctcgccgggggtgtgcgcgacatggccgactgggtcaacaagctt
tacgggcaggcctttgccgcaatctacgtgcagcccggggccaaagtcgctgtccatctg
gagcagccccttaacatcgactacgacgtcaaggggcggcgggtcaatcaccgcatcgga
gaagctcatgcgtcagatctggactga

DBGET integrated database retrieval system