KEGG   Cupriavidus necator N-1: CNE_1c27780Help
Entry
CNE_1c27780       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438
Motif
Other DBs
NCBI-ProteinID: AEI78092
UniProt: G0ETP3
Position
1:complement(2883225..2884145)
Genome map
AA seq 306 aa AA seqDB search
MKRRILSALAGLLLGMAQVSISHAVELLRWQRLPLAVALVVGQERVIFIDRNVRVGLPEN
IASHLRVQSAGGAIYLRASEPIPPSRLQLQDVESGALILLDIAAEPAKAGQPALEPVRII
VGDAASSPANALAGTVTSEHQPRETAGAATRRASPVPAVLTRYAAQNLYAPLRTVEPVAG
VRRVNLRRDLALHTLLPVLPLRAQALAAWRLDDQWVTAVKLTNTSARRLVLDPRALQGDF
VAATFQHATLGPAGASTDTTVVYLVTRGHGLAESLLPKVATLDATASMPVAAAAGQAEGG
DPHNEK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcgtatcctttcggccttggctggccttctgctcggcatggcacaagtctcc
atcagccacgctgtggagctcctgcgctggcaacgtttgcccctggctgtggcgctagtg
gtcggtcaggagcgcgtgatcttcatcgatcgtaacgtgcgcgtcggcctgccggagaac
atcgcatcgcacctgcgcgtgcagagcgccggcggcgcgatctatctgcgcgcgagcgag
ccgattccgccctcgcggctgcaactgcaagacgtggagtccggggcgctgatcctgctc
gacatcgctgccgagccagccaaggcaggccagcctgcgctcgagcctgtgcgcatcatc
gtgggcgatgcggcatcatcgccggcgaacgctctggccggtaccgtcacaagcgagcac
cagccgcgcgagacggcaggcgcggcgacgcggcgcgcgagcccggtgcctgcggtgctg
acacgctatgcggcacaaaacctctatgcaccgctgcgcacggtggagccggtggccggc
gtccgccgcgtgaatctacgccgcgatctggctctacacacattgctacctgtgctcccg
ttgcgcgcgcaggcgctggccgcgtggcggctcgatgaccagtgggtgacggcagtgaag
ctcactaacacgtccgcacggcgcttggtactcgacccgcgcgcactgcaaggcgatttc
gtcgcggcaaccttccaacatgcgaccttggggccggctggcgcttcgaccgacaccacc
gtggtctatcttgttacccgtggccatggcctggccgagtcgctgctgccaaaggtggca
accctcgacgccaccgctagcatgccggtggcggccgcggccggccaggccgaaggagga
gatccccataatgaaaagtaa

DBGET integrated database retrieval system