KEGG   Cupriavidus necator N-1: CNE_1c27820Help
Entry
CNE_1c27820       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3262 DUF485
Motif
Other DBs
NCBI-ProteinID: AEI78096
UniProt: G0ETP7
Position
1:complement(2885679..2885918)
Genome map
AA seq 79 aa AA seqDB search
MTLAADQVAAFQANSGFTPATVSTVVLGFVFAVLLLWGVWALRTAYVGWAENRTTERQFV
GVAVRFVAMYLTLSFFLLS
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgccgctgatcaagtcgccgctttccaggccaacagtggtttcacgcctgcg
accgtctccaccgttgtcctcggcttcgtcttcgccgttctgctgctctggggtgtttgg
gcgctgcgtaccgcctatgtcggttgggccgagaaccggacaaccgagcgccagttcgtc
ggcgtggccgtacgattcgtcgcgatgtacctgacgctgagcttctttctcctgtcctga

DBGET integrated database retrieval system