KEGG   Cupriavidus necator N-1: CNE_1c28050Help
Entry
CNE_1c28050       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoPQ_related AXE1 AzlC
Motif
Other DBs
NCBI-ProteinID: AEI78119
UniProt: G0ETS0
Position
1:2904470..2905849
Genome map
AA seq 459 aa AA seqDB search
MGIARQAAWLLASLLLPGIAAAQAQPAGPAAFFDMQAVRDESTLAPVISRDTVVPSRARP
GKRVRVIELRFTSQDWKGLPWTHPARIYVPDGYQGGGNAGIIGTERQFFDEPAWPRHTIP
GTGLNTEAEYAEGTAIDLGMPVMLFSNPAEDYWGMNESDLTGYALKQVMETGDLTWNGYY
PIAMAYLRAITLMHNLPGVRTERAVLMGCSKRGFAVSIATGVDPDRVAGVMATCYYGGNS
LYFLARKYAEFGPGVGGPAQQRTGPGFQPADAVLRTINNPTGFRMLTHFDPYMWRKQMRS
SFLVALGTNDEFFALGTPNSMLTEMSGDKAFLAVDNLPHSWVSAKHLAAWRMWLAHTFLG
RKLPAIEASGVAQGGQFAVRASVRAEAAPARVLLYYAYNPVAADWRKARWESVPMRTDGE
MYAAGLPLRDGYRLAYYVEVEDKGTGGTGFVSSLVNFAN
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgggcattgcgcggcaagcggcctggctgcttgcgtcgctgctgctgcccggcatcgcc
gcagcgcaagcgcagccggccggcccggcggcgttcttcgacatgcaggccgtacgcgac
gaaagcacgctggcaccggtgatttcccgcgataccgtggtgcccagccgcgcgcgcccc
ggcaagcgcgtgcgcgtgatcgaactgcgcttcaccagccaggactggaagggcttgcca
tggacgcacccggcgcgcatctacgtgcccgacggctaccagggcggcggcaacgcgggc
atcatcggcaccgaacggcagttctttgacgagcctgcctggccgcgccacaccatcccc
ggcactggcctgaacaccgaagccgaatacgccgaaggcaccgccatcgacctgggcatg
cccgtcatgctgttctccaacccggccgaagactactggggcatgaacgaatccgacctg
accggctatgcgctgaagcaggtgatggaaaccggcgacctgacctggaacggctattac
ccgatcgcaatggcctacctgcgcgcgatcaccctgatgcacaacctgcccggcgtacgc
accgagcgcgccgtgctgatgggctgctccaagcgcggcttcgccgtcagcatcgccacc
ggcgtcgaccctgaccgcgtcgcgggggtgatggccacctgctattacggcggcaacagc
ctgtacttccttgcgcgcaagtacgccgagttcggccccggcgtcggcggccccgcgcag
cagcgcaccggccccggcttccagcccgccgacgccgtgctgcgcacgatcaacaacccc
acgggctttcgcatgctgacgcactttgacccgtatatgtggcgcaagcagatgcgatcc
agcttcctggtcgcgctcggcaccaacgacgagttcttcgcgctgggcactcccaacagc
atgctgaccgagatgtccggcgacaaggccttcctggcggtggacaacctgcctcactcg
tgggtctcggccaaacacctggctgcatggcgcatgtggctggcgcataccttcctgggc
cggaagctgcccgcgatcgaagccagcggggtggcgcagggcgggcagttcgcggtgcgg
gcgagcgtcagggccgaagcggcgcctgcccgcgtgctgctctattacgcctacaacccg
gtcgccgccgactggcgcaaggccaggtgggagtcggtgccgatgcgcaccgatggcgag
atgtatgccgccggactgccgctgcgcgatgggtatcggctggcgtactacgtagaagtg
gaggacaaaggcacaggcgggacaggatttgtcagttcgctggtgaactttgcgaactag

DBGET integrated database retrieval system