KEGG   Cupriavidus necator N-1: CNE_1c28060Help
Entry
CNE_1c28060       CDS       T01564                                 

Definition
(GenBank) transglutaminase-like enzyme
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transglut_core DUF553
Motif
Other DBs
NCBI-ProteinID: AEI78120
UniProt: G0ETS1
Position
1:2905988..2906848
Genome map
AA seq 286 aa AA seqDB search
MNRLRYAVSLSYEVMDPMADFLLNIEAARTPRQSVVSEQLTLPPGLETARYTDPVLANRL
LRLRAPRGRLGIRYEAIIDIDHYLEDGDRLSEVPVAELPFDVLPYLAPSRYCESDRLMEF
ASREFGGMLRGYVRVYAIREWVRNHVRFLSRSTNERTSAADTIVERTGVCRDFAHLMIAL
CRALSIPARMSSSLDYGADPSTGAPDFHAVVEVYLSHRWYLLDPSGISIPTGLLRIGTGR
DAADIPFAAIFGQVRSERPAVEIEPLTDAAAGIGMPVFTPQAISTW
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcctcaggtacgcagtaagcctgtcctatgaggtcatggatcccatggcagac
ttcctgctcaatatcgaagccgcccgcacgccccggcagtccgtcgtctcggagcagctg
acgctgccgcccggcctcgagaccgcccgctacaccgatcccgtgctggccaaccggctg
ctcaggctgcgcgcgccccggggccgcctcggcatccgctatgaggcgatcatcgacatc
gatcactacctggaagacggcgacaggttgtcggaagtgcccgttgccgagctgcccttc
gatgtcctgccctacctggcaccaagccgctactgcgagtctgaccgcctgatggaattc
gccagccgcgagttcggcggcatgctgcggggctatgtgcgcgtctacgccatccgcgag
tgggtgcgcaatcacgtgcgcttcctgtcgcggtccaccaacgaacgcacctcggctgcc
gacaccatcgtggagcgcaccggtgtctgcagggatttcgcccacctgatgatcgccctg
tgccgcgcgctgagcatcccggcacgcatgtccagcagcctcgactatggtgcggaccca
agcacgggcgcgccggatttccacgcggtggtggaggtctacctgtcgcaccgctggtac
ctgctggatccttcgggcatctcgatccccaccggcctgcttcgcatcggcaccggccgg
gatgccgcggacataccgtttgcggccatcttcggccaggtaaggtcggagcggcccgcg
gtggaaatcgagccgttgacggatgcggcggctggtatcggcatgccggtgtttacgccg
caggcgatttcgacgtggtag

DBGET integrated database retrieval system