KEGG   Cupriavidus necator N-1: CNE_1c28080Help
Entry
CNE_1c28080       CDS       T01564                                 

Gene name
trmB
Definition
(GenBank) tRNA (guanine-N(7)-)-methyltransferase TrmB
  KO
K03439  
tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
cnc  Cupriavidus necator N-1
Brite
Enzymes [BR:cnc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     CNE_1c28080 (trmB)
Transfer RNA biogenesis [BR:cnc03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    CNE_1c28080 (trmB)
 Prokaryotic Type
    CNE_1c28080 (trmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2907088..2907876
Genome map
AA seq 262 aa AA seqDB search
MLPQDPSTDPTPADDAAPVDSAGQASAPSPADPEGVAHPRRIRSFVRRAGRTSTGQQRAI
DEVGPRMMVPYAPQPLDWEAVFGRKAPSILEIGFGMGETTAHIAGLRPQDNFLGCEVHEP
GVGALLKLIDERGLGNVRILQHDAVEVIAHMLTDDCLDGVHIYFPDPWHKKRHNKRRLVQ
PPLVKVLAARLKPGGYIHCATDWEEYAHQMLEVLSGEPLLENTSTAADGFAERPDYRPVT
KFERRGVRLGHGVWDVVFRKRA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcttccccaagaccccagcaccgatccgacgccggctgacgacgccgcgccggtagac
agcgccggacaagcgtccgctccctctcctgccgatcctgaaggcgttgcgcatccgcgc
cggatccgttcgttcgtgcgccgcgcggggcggacctcgaccgggcagcagcgtgccatc
gacgaagtcgggccgcgcatgatggtgccgtatgcgccacagccactggactgggaagct
gtatttggccgcaaggcaccgtcgatcctggagatcggcttcggcatgggcgagaccacc
gcgcatatcgccggcctacggccgcaagacaacttcctgggctgcgaggtacatgagccc
ggcgtgggcgcgctgctcaagctgatcgacgagcgcggcctgggcaatgtgcggatcctc
cagcacgatgcggtggaagtgattgcgcatatgctgaccgacgactgcctggacggcgtg
catatctacttccccgacccctggcacaagaagcgccacaacaagcgccggctggtgcag
ccgccgctggtgaaggtgctggccgcgcgcctgaagccgggcggctatatccactgcgcg
accgactgggaagagtatgcgcaccagatgctggaagtactgtcgggcgagccgttgctg
gagaacacttcgaccgctgcggacggatttgccgagcggccggattaccggcccgtgacc
aagttcgagcggcgcggcgtgcgcctcgggcacggcgtgtgggacgtggtcttccgcaag
cgcgcctaa

DBGET integrated database retrieval system