KEGG   Cupriavidus necator N-1: CNE_1c28150Help
Entry
CNE_1c28150       CDS       T01564                                 

Gene name
pcm3
Definition
protein-L-isoaspartate O-methyltransferase Pcm (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cnc  Cupriavidus necator N-1
Brite
Enzymes [BR:cnc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CNE_1c28150 (pcm3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2915376..2916029
Genome map
AA seq 217 aa AA seqDB search
MDLEKARFNMIEQQIRPWDVLDQEILDLLAVVKREQFVPAAYASLAFVDMEIPLPAGQNM
LAPRVEARILQDLAVRKHENVLEIGAGSGYMAALLANRARHVLTVDIVPELVELARTNLA
NAGVTNVDVAEGNAADGWSAAAPYDVICISGSLPAIPQSILSQVKVGGRIAAFIGELPVM
EARLVTRVSETEYQVVNLFETAVKPLQGAARPSQFQF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgaaaaagcccgattcaacatgatcgaacagcaaatccgcccgtgggacgtg
ctggaccaggaaatcctggacctgctggcggtggtcaagcgggagcagttcgtcccggcc
gcgtacgcctcgctggcgttcgtcgacatggagattccgctgcccgccgggcagaacatg
ctggccccgcgcgtggaagcccgcatcctgcaggacctggccgtgcgcaagcatgagaac
gtgctggaaatcggcgccggctccggctacatggccgccctgctggccaaccgcgcgcgc
cacgtgctgaccgtggacatcgtgcccgagctggttgagctggcccgcaccaacctggcc
aacgccggcgtcaccaacgtcgacgtggccgaaggcaacgccgccgacggctggagcgcc
gccgcgccctacgacgtgatctgcatctcgggctcgctgccggcgattccgcagtcgatc
ctgtcgcaggtcaaggtgggcggccgcatcgccgccttcatcggcgagctgccggtgatg
gaagcgcgcctggtcacgcgcgtgtccgagaccgaataccaggtcgtcaacctgttcgaa
actgcggtcaagcccctgcagggcgcggcccggccgtcgcaattccagttctga

DBGET integrated database retrieval system