KEGG   Cupriavidus necator N-1: CNE_1c28170Help
Entry
CNE_1c28170       CDS       T01564                                 

Gene name
acrC2
Definition
(GenBank) cation/multidrug efflux system outer membrane porin
  KO
K12340  outer membrane protein
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc01501  beta-Lactam resistance
cnc01503  Cationic antimicrobial peptide (CAMP) resistance
cnc02020  Two-component system
cnc03070  Bacterial secretion system
Module
cnc_M00647  Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    CNE_1c28170 (acrC2)
  Signal transduction
   02020 Two-component system
    CNE_1c28170 (acrC2)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CNE_1c28170 (acrC2)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CNE_1c28170 (acrC2)
Transporters [BR:cnc02000]
 Other Transporters
  Pores ion channels [TC:1]
   CNE_1c28170 (acrC2)
Secretion system [BR:cnc02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter [MD:M00325]
   CNE_1c28170 (acrC2)
  RTX toxin transporter [MD:M00326]
   CNE_1c28170 (acrC2)
  RaxAB-RaxC type I secretion system protein [MD:M00339]
   CNE_1c28170 (acrC2)
  AlgE-type Mannuronan C-5-Epimerase transporter [MD:M00571]
   CNE_1c28170 (acrC2)
Antimicrobial resistance genes [BR:cnc01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    CNE_1c28170 (acrC2)
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    CNE_1c28170 (acrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP
Motif
Other DBs
NCBI-ProteinID: AEI78130
UniProt: G0ETT1
Position
1:2916442..2917959
Genome map
AA seq 505 aa AA seqDB search
MTFAPNALPGVIRTRLAIAVSVLAPLLAMLPAAPASAADLLQVYRDAQANDAQFASARSQ
LLATRERLPQGRAGLLPQVVGTAGANRTKLDQTASLPVGAGASASGTRFFNNNNWQLQLS
QPLFRWDRWETYKQGELASLAGEVSFHQAELDLITRSAQAYFDVLAAQDNLYLARAQKKA
ISEQLEQAKRNFEVGTATITDTNDAQARYDLATSTEIASQSDLEIKRATLQQITGKPVDE
VLGLRPEAPIPGPQPPDVNAWAAQAETSNLQVNLASYNLETAQRETNKAKAGHLPSVDLV
ASYGFTNQTGSATQAISTHYNASQIGVQLTMPIFAGGQIQSRVRETLALADKAASDLEFA
RRTAAQTARQTYSGVSNGLAQVKALEAAERSATSAVESNQLGYEVGVRINIDVLNAEAQL
FSTRRDLAKARYDTIMNGLRLKASTGVLQEADVVQINTLLTSSPGALYKLPAPAQAGARA
PATPRASVERRGTRREATPAGAPRT
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttgcgcccaacgccctgcccggagtgatccggacacgcctggcgatcgcggtt
tccgtgcttgccccgctgctggccatgctgccggcggcaccggcaagcgcggccgacctg
ctgcaggtctatcgcgatgcgcaagccaatgacgcgcagtttgccagcgcgcgctcgcag
ctgctggccacacgcgagcggctgccccagggccgcgccgggctgctgccgcaggtggtt
ggcaccgcgggcgccaaccgcaccaagctcgaccagacggcttcgctgccggtcggcgcc
ggggccagcgcctccggcacgcgcttcttcaacaacaacaactggcagctgcaactgagc
cagccgctgttccgctgggaccgctgggaaacctacaagcagggcgaactggcgtcgctc
gccggtgaagtcagcttccaccaggctgagctcgacctgatcacccgcagcgcgcaggcc
tacttcgacgtgctggcggcacaggacaacctctacctggcacgcgcgcagaaaaaggcc
atctccgagcagctggagcaggccaagcgcaatttcgaggtcggcaccgccaccatcacc
gacaccaacgacgcccaggcccgctacgatctggccacctcgaccgagatcgcctcgcag
agcgacctggagatcaagcgcgccacgctgcagcagatcaccggcaagccggtcgacgaa
gtgctgggcctgcgccccgaggcgcccatccctggcccgcagccgcccgacgtcaacgcc
tgggccgcgcaggcagagaccagcaacctgcaggtgaacctggccagctacaacctggaa
accgcccagcgcgagaccaacaaggccaaggccggccacctgccctcggtcgatctggtg
gcgtcatacggtttcaccaaccagaccggcagcgccacgcaggcgatctccacccattac
aacgcctcgcagatcggcgtgcaactgaccatgccgatcttcgccggcggccagatccag
tcgcgcgtgcgcgagaccctggccctggccgacaaggccgccagcgacctggaattcgcg
cgccgcaccgccgcgcagacggcacgccagacctactccggcgtgtccaacggcctggcc
caggtcaaggccctggaagccgccgaacgctcggccaccagcgcggtggaatccaaccag
ctcggctatgaagtgggcgtgcgcatcaatatcgacgtgctgaacgccgaagcgcaactg
ttctccacccggcgcgacctcgccaaagcccgctacgacaccatcatgaacggcctgagg
ctgaaggcctccactggcgtgctgcaggaagccgacgtggtgcagatcaacaccctgctg
acctcgtcgcccggtgcgctgtacaagctgcccgcgcccgcccaggccggcgccagggcc
ccggcaaccccgcgcgcctcggtcgagcgccgcggcacgcggcgcgaagccacgcctgcc
ggcgcaccgcgcacctga

DBGET integrated database retrieval system